KEGG   Anaerolinea thermophila: ANT_17000Help
Entry
ANT_17000         CDS       T01410                                 

Definition
(GenBank) putative glycosidase
  KO
K01208  cyclomaltodextrinase / maltogenic alpha-amylase / neopullulanase [EC:3.2.1.54 3.2.1.133 3.2.1.135]
Organism
atm  Anaerolinea thermophila
Pathway
atm00500  Starch and sucrose metabolism
atm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ANT_17000
Enzymes [BR:atm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.54  cyclomaltodextrinase
     ANT_17000
    3.2.1.133  glucan 1,4-alpha-maltohydrolase
     ANT_17000
    3.2.1.135  neopullulanase
     ANT_17000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 Alpha-amylase_C Cyc-maltodext_C DUF1794
Motif
Other DBs
NCBI-ProteinID: BAJ63726
NITE: ANT_17000
UniProt: E8N5L2
Position
1907871..1909328
Genome map
AA seq 485 aa AA seqDB search
MSANFQTPKWVHDAVFYQIFPDRFAKSALVEKPTHLEDWDAPPTPYGFKGGDLLGVTEHL
DYLQDLGITAIYFTPIFQSASNHRYHTHDYFKVDPLLGGEKAFQTLLKEAHRRNIRIVLD
GVFNHASRGFFQFNHILECGKQSPYLDWFKIHGFPLNAYEGKPRYECWWSIPALPTFNHA
NPQVRKFIMEVGRYWLEQGIDGWRLDVPFEVKEPGFWEEFRSVVKSVNPEAYITGEIPWD
ARPWLQGNQFDGVMNYLLTYSLWSFFGGEHLQEDLVGHWRSHGPEYFVKDAESFAQQITL
LQNLYPLPAVQAQMNLLDSHDTARFLSLVNGRKEALRLAALVLFTYPGAPTIYYGDEIGM
EGGKDPDCRRGFPWDTSRWDMDLRNYFKSLIMIRKSHPALRDGSWEILKAENQWLAYARK
HENDYVVVLLNNSPQTNFLEVTLKEFSGEESLKNLLNGEMVKIEGNILRYKLAPYSGTIL
SQGQY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgcaaactttcaaacccccaaatgggtgcacgatgcagttttttatcaaattttt
cctgaccgtttcgccaaaagcgcacttgtagaaaagccaacccatttagaggattgggac
gcccccccgactccatacgggttcaaaggaggagatctgctaggggtaactgaacatctg
gattatcttcaggatttgggaattactgcaatttatttcaccccaatttttcagtctgct
tctaatcatcgataccatacccacgattactttaaagtggacccccttctcggtggagaa
aaagcctttcaaaccttgctcaaagaagcccatcgcagaaacattcgcatcgtgctggat
ggtgtattcaaccatgccagtcggggatttttccagttcaaccacattctggagtgcggg
aaacaatcaccttatcttgactggtttaagatccatggcttccctttgaacgcatacgaa
ggtaaaccgcgttatgaatgctggtggagtatccctgctttaccaaccttcaaccatgcc
aacccacaagttcgcaaattcatcatggaagtggggcgatactggcttgaacagggcatt
gatgggtggcggttagatgtaccttttgaagtcaaagagccaggcttttgggaagagttt
cgaagcgtggttaaatcggtcaatccagaggcatatattactggcgaaatcccatgggat
gctcgcccatggttacaggggaatcaatttgacggggtcatgaattacctgctgacatat
tctctgtggagcttcttcggcggagaacatttgcaggaagatttggtgggacactggcga
agccatggtcctgagtattttgtaaaagatgcggaatcctttgcccaacaaattactttg
ctccagaacctctatccgctgcctgctgttcaagcccagatgaaccttcttgatagccat
gatacagcccgcttcctcagcctggtgaacggtcgcaaagaagccctgcgccttgcggct
ctggtattatttacatatcccggagcaccaacaatttactacggtgatgaaattggaatg
gaaggcggcaaagatccggactgccggcgtggttttccatgggatacctcccgatgggat
atggacctaagaaactacttcaaatccctaatcatgatccggaaaagccatccagccctg
cgagatggttcatgggaaatcttaaaggctgagaatcaatggctagcctatgcacgcaag
catgaaaacgattatgttgtagttttgttgaataacagcccccaaacaaatttccttgaa
gtcacccttaaggaattctccggagaagaaagccttaagaaccttctcaatggagaaatg
gtgaaaatagaagggaacattttaaggtataaactcgctccatattcaggaacaattctc
tctcaagggcagtattga

DBGET integrated database retrieval system