KEGG   Anaerolinea thermophila: ANT_17020Help
Entry
ANT_17020         CDS       T01410                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
atm  Anaerolinea thermophila
Pathway
atm00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ANT_17020
Enzymes [BR:atm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     ANT_17020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C DUF4838 Glyco_hydro_14 Cyc-maltodext_C DUF4350
Motif
Other DBs
NCBI-ProteinID: BAJ63728
NITE: ANT_17020
UniProt: E8N5L4
Position
1910202..1912202
Genome map
AA seq 666 aa AA seqDB search
MTTQRSRKVLHIGAAYYPEHWKSEQWLSDIRLMQELGLSVVRMGEFAWSSLEPSKGNFQF
EWLDQAINLLALHDIRTVLGTPTAAPPAWLVSEHPEILATNEEGRKVQFGNRCHYCVNST
AFHEATAKLVKAMAEHFGSNPNIIGWQIDNEFNRVCYCEHCQALFQEYLKEKYKSLDELN
RRWTTAYWSQTYNDWSQIPIPIGPHNPALMLEWKRFVTRSYRKFQRMQIDLLRPHLREEV
WITHNFMGWFDGFDHYEMSTDLDMASWDWYIGMGHNEPVFSSATHDLTRGFKKKNFWVME
IQPNTVNWAKINNPLYKGEARTMAWQAIGKGADAVLYWQWRSALNGQEQFHGTLVDQSGQ
PRPFFEEVKQIAKEFRELSSVFEYTQVESRVAILNDYESRWAISWQKHHRDFDYVALLLS
YYRPLCQLNIPVDIISPDQSLEEYKLVLAPALTIVDEARIAHLKSFVDNGGHLVLGARTA
VKNRDNAFHPLRPPAFLTHLTGAEVEDFYALNEEVPLQGNWFTGTARIWAERMKIIDPDS
TLPVATYGVSNGWLDGQIAMTIHNHGSGLVYYAGAYLDDTAMFAYLKRVATNAGVQGLFE
APAGVQIYRRVRTYDKKEVFVIVNHTRMEQIVKLDNNTYDDHISGKRIAGQIRLSPYGVA
VLTKTI
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgaccacacaacgctctcgaaaagtccttcacattggcgcagcctattaccctgaacac
tggaaatccgagcagtggttaagtgatatccgcctgatgcaggaacttggcttgagcgtc
gttcgcatgggggaatttgcctggtccagtttagagccctccaaagggaattttcagttt
gaatggcttgatcaagccatcaaccttcttgctttgcacgacatacgaacagtcctgggg
actcccaccgctgcccctccagcctggcttgtgagtgagcaccctgagatactagccaca
aacgaagaaggaaggaaagttcaatttggaaaccgatgccattattgcgtaaattcaacg
gcttttcatgaggcaacggccaagttggtcaaagccatggcagaacattttgggagcaat
cccaacatcattggctggcaaattgacaatgaatttaatcgagtttgttattgcgaacac
tgccaggctctttttcaggaatacctcaaagaaaagtataaatctctggacgaattaaac
cgacgatggactactgcatactggagtcaaacctataacgattggagccagattcccatc
ccaattggtccccacaaccctgcactcatgctggaatggaaacgcttcgtcacccgaagt
taccggaaatttcaaagaatgcagattgacctcctgagacctcacctgagagaagaagtg
tggatcacccacaacttcatgggatggtttgacgggttcgaccactatgaaatgagcact
gacctggatatggcttcatgggactggtacattggcatggggcataacgagcccgtgttc
tcgagcgccacccatgacctcactcgcggattcaagaagaagaacttttgggtaatggaa
atccagcccaatacggtcaattgggcaaaaatcaacaatcctctttacaagggtgaagcc
agaaccatggcatggcaagccattggcaaaggtgccgacgctgtgttgtactggcaatgg
cgttctgcgctcaatggacaggagcaattccatggaacgctggtggatcaatccggtcag
ccaaggcccttcttcgaagaagtgaagcaaattgccaaagagttcagggaactttcttca
gtattcgaatatacccaggttgagtcccgagtagccatccttaatgattatgaaagccgt
tgggcaatttcgtggcagaagcatcaccgggattttgattatgtggcgcttctgctgtct
tactaccggcccctatgccagttaaatattccagtggatatcatctctcccgatcaatct
ctggaagagtataaacttgtcctggctccagcgctcacaattgtagacgaggcgcgcatt
gcccatttaaagagttttgtggataacggtgggcatctggtgctgggagcacgaacagcg
gtcaagaatcgtgacaatgcctttcatccgttgcgccccccggcattcctcactcacctc
accggggcagaagtagaagacttttatgccctcaacgaagaagtacctcttcaaggcaac
tggttcactggaacagcgcgaatttgggcagaacggatgaagattattgatccagactct
accctccccgtagcaacttatggcgtttcgaatggctggctcgatggtcaaattgccatg
acgattcacaaccacggaagcggattggtttattacgcgggcgcttatctggatgacaca
gcgatgttcgcctacctcaaaagggttgcaacaaatgcaggggttcaggggttatttgaa
gcacctgcgggagtgcaaatctatcgcagggtacgcacatatgacaagaaagaagtattt
gtaattgtcaatcacacaagaatggaacaaattgtcaaactggacaataatacttacgat
gatcacatcagtggtaagcgtattgccggacaaattcggctctctccatatggtgttgcc
gttctaaccaaaacaatttga

DBGET integrated database retrieval system