KEGG   Anaerolinea thermophila: ANT_20570
Entry
ANT_20570         CDS       T01410                                 

Gene name
sucD
Definition
(GenBank) succinyl-CoA synthetase alpha chain
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
atm  Anaerolinea thermophila
Pathway
atm00020  Citrate cycle (TCA cycle)
atm00640  Propanoate metabolism
atm00660  C5-Branched dibasic acid metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
atm01120  Microbial metabolism in diverse environments
atm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ANT_20570 (sucD)
   00640 Propanoate metabolism
    ANT_20570 (sucD)
   00660 C5-Branched dibasic acid metabolism
    ANT_20570 (sucD)
Enzymes [BR:atm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ANT_20570 (sucD)
SSDB
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 Ribul_P_3_epim
Other DBs
NCBI-ProteinID: BAJ64083
UniProt: E8MXK2
Position
complement(2311547..2312410)
AA seq 287 aa
MSILVNKQTRLVVQGITGNEGLFHTTQMVAYGTNVVAGVTPGKGGEWVLEGKIPVFDTVR
SAVETTGANTSVIFVPARFAPDAILEAADAGVSLIVCITEGIPVQDMMRVRSYLDQKKVR
LVGPNCPGILTPGEAKVGIIPNNISIPGNIGIVSRSGTLTYEVLYALKMAGKGASTCVGI
GGDPINGTNFVDVLDMFEADPHTDQVVMIGEIGGTDEEKAAEFIARNMTKPVVAFIAGQS
APPGKRMGHAGAIIEGGTGTARDKVLALEKSGVRVANHPEEIPGLLG
NT seq 864 nt   +upstreamnt  +downstreamnt
atgagcattctggtcaataaacaaacccgtctggtggttcaaggcattacaggtaatgaa
ggtcttttccacaccacgcaaatggtggcttacggtaccaatgtggtggcaggcgtcacc
ccggggaaagggggagagtgggtattagaagggaaaatcccggtctttgatacggtgcgc
tctgcggtagaaaccacgggtgccaataccagtgtgatttttgtccctgcccgattcgcc
cccgatgctattctggaagccgcagatgcgggggtttcgctcattgtatgtattacggaa
ggcattcctgtacaggatatgatgcgggtgcgcagttatctggaccagaaaaaagtgcgc
ctggttggtccgaactgccctggtattttgacccctggggaagccaaggtgggcattatc
cccaataatatttccattccgggaaatattggtattgtctcccgctcgggcactttgacg
tatgaagtcttatatgctctgaagatggctggaaaaggtgccagcacctgtgtggggatt
gggggagatcccatcaacgggacaaattttgtggatgtgctggatatgtttgaagcggat
cctcacaccgatcaggtggtgatgattggcgaaatcggcggtaccgatgaagaaaaagcg
gcagagtttatcgcccgaaatatgaccaaaccggtggttgcctttatcgccgggcagtca
gccccgcctggcaaacgtatggggcacgctggggcaatcattgaaggcggaacaggtaca
gccagggataaagttctggcgctggaaaaaagtggtgttcgcgtagccaatcacccggag
gaaattcctggcttgcttggatag

KEGG   Anaerolinea thermophila: ANT_20580
Entry
ANT_20580         CDS       T01410                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
atm  Anaerolinea thermophila
Pathway
atm00020  Citrate cycle (TCA cycle)
atm00640  Propanoate metabolism
atm00660  C5-Branched dibasic acid metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
atm01120  Microbial metabolism in diverse environments
atm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ANT_20580 (sucC)
   00640 Propanoate metabolism
    ANT_20580 (sucC)
   00660 C5-Branched dibasic acid metabolism
    ANT_20580 (sucC)
Enzymes [BR:atm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ANT_20580 (sucC)
SSDB
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2 ATP-grasp Ligase_CoA_2
Other DBs
NCBI-ProteinID: BAJ64084
UniProt: E8MXK3
Position
complement(2312407..2313549)
AA seq 380 aa
MKLHEYQSKAIFHRYGVPIPKGRTTTMASEAKHFAEELGGKVVIKAQVLVGGRGKAGGIR
LAKTPKEAEELATTILGMEIKGLPVRKILVDEAVSFEKEIYLGITNDRGARRPVMMASAA
GGVDIEEVARVSPEKIIKIHIDPLLGLREYQARDLAVSIDLPRPLWRSFAEVAYGLWKAY
TENDATLAEINPLVITSDKKLLALDGKMVVDDNALFRHPDLVEMRDLDAEDWAEIEARKF
GLSYISLDGEIGCMVNGAGLAMATMDIIKLCGGEPANFLDIGGGAGAEKVAAALRIILSD
PKVKAVLFNIFGGITRCDEVARGILTALAEVKPNIPMVVRLVGTNAEEGRRLLAEAKMIT
AETLLEAAQKAVAVVKGEAK
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgaaactacatgaatatcaatccaaagccatttttcaccgctatggtgtgcccattccc
aagggaaggacgaccaccatggcaagcgaggcaaagcattttgccgaagaattgggcgga
aaagttgtcattaaagcccaggtgctggtaggtgggcgtggcaaagccggggggattcgc
ctggcgaaaacgcccaaagaagccgaagaactggctaccacgattctgggcatggaaatc
aaaggattgccggttcgcaaaatcctcgtggatgaagccgtgagttttgagaaggagatt
tacctgggaatcaccaacgatcgcggggcgcgccgtccggtgatgatggcttctgccgct
ggaggggtggatattgaagaggtggctcgagtttccccggagaaaattatcaagattcat
atcgacccgcttctcgggttgcgcgaatatcaggcgcgcgatctggcggtaagcattgat
ctcccccgtccgttgtggcgctcattcgccgaagtggcttatggattgtggaaagcctat
accgaaaacgacgctaccctggcagaaatcaatcccctggtcattacttccgataaaaaa
ttactcgccctggacggcaagatggttgtggatgacaatgcgctcttccgccaccccgat
ttagttgaaatgcgcgatttggatgccgaagattgggcagaaatcgaagcccgtaagttt
ggactttcttacattagcctggatggtgaaatcgggtgtatggtgaatggcgctggactt
gccatggcaaccatggatatcatcaaattgtgtgggggtgaacctgccaatttcctcgat
attggcgggggggccggtgcggaaaaggttgccgccgctttgcgtatcatcctgagcgat
cctaaagtcaaggcagtgctcttcaacatttttggggggattactcgttgtgatgaagtg
gcgcgtggaatcctcactgctcttgccgaagtgaaacccaatattcctatggtagttcgg
ttggtaggtaccaacgccgaagaaggtcgcaggctgctggctgaagccaagatgattacc
gctgaaacgcttttggaagccgctcaaaaggcggttgctgtggtgaaaggggaagcaaaa
tga

DBGET integrated database retrieval system