KEGG   Anaerolinea thermophila: ANT_22140
Entry
ANT_22140         CDS       T01410                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
atm  Anaerolinea thermophila
Pathway
atm00020  Citrate cycle (TCA cycle)
atm00190  Oxidative phosphorylation
atm00650  Butanoate metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
atm01120  Microbial metabolism in diverse environments
atm01200  Carbon metabolism
Module
atm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ANT_22140 (sdhB)
   00650 Butanoate metabolism
    ANT_22140 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ANT_22140 (sdhB)
Enzymes [BR:atm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ANT_22140 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     ANT_22140 (sdhB)
SSDB
Motif
Pfam: Fer2_3 Fer4_10 Fer4_8 Fer4_17 Fer4_7 Fer4_9 Fer4 Fer4_4 Fer4_6 Fer4_15 Fer4_2 Fer4_13 Fer4_21 Fer4_16 Fer4_20
Other DBs
NCBI-ProteinID: BAJ64240
UniProt: E8MY09
Position
complement(2445639..2446349)
AA seq 236 aa
MQVKLRVFRFDPERDQKPRYDTFIMDVDPNDRVLDLLEYIKADFDPTLALRRSCAHGVCG
SDAMRVNGRNYLACKVLVKNLNADTITVEPLLGLRVIKDLIVDMGPFFENYRSVLPYLIN
DEPLPEDGKERLQSPEQQLRFEDTTKCILCAACTTSCPSFWADDRYVGPAAIVNAHRFIF
DSRDRAAEKRLNILNEQMGVWRCRTAFNCTEACPREIHITQAIAEVKKAIITGKIE
NT seq 711 nt   +upstreamnt  +downstreamnt
atgcaggtcaaattgcgtgttttccgcttcgacccggaacgggatcaaaagccccgttat
gatacctttatcatggacgtggaccccaatgaccgggttttggatttgcttgaatacatc
aaagccgattttgaccccacccttgccctgcgccgctcatgcgcgcatggagtgtgtggt
tccgatgccatgcgtgtcaacgggcgtaattatctggcatgtaaggtcctggtgaaaaac
ctcaatgccgacaccatcacggttgaaccgctcctgggattgcgggtcatcaaagactta
attgtggacatgggacccttctttgagaattaccgctctgtcttgccttatctgatcaac
gatgagcctcttcctgaggatgggaaagagcgcctccaatccccggaacagcaactgcgc
tttgaggacaccaccaagtgcatcctctgcgcggcatgcaccacttcctgcccgtctttc
tgggcagatgaccgctatgtgggaccggcggcaatcgtcaacgcgcatcgttttatcttt
gatagtcgtgatcgcgccgccgaaaaacgtctgaatatccttaacgagcaaatgggggtg
tggcgctgccgtacggcgttcaactgtacagaagcctgtccgcgggagattcacattacc
caggccattgctgaagtcaagaaagccattattaccgggaaaattgagtag

KEGG   Anaerolinea thermophila: ANT_22150
Entry
ANT_22150         CDS       T01410                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
atm  Anaerolinea thermophila
Pathway
atm00020  Citrate cycle (TCA cycle)
atm00190  Oxidative phosphorylation
atm00650  Butanoate metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
atm01120  Microbial metabolism in diverse environments
atm01200  Carbon metabolism
Module
atm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ANT_22150 (sdhA)
   00650 Butanoate metabolism
    ANT_22150 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ANT_22150 (sdhA)
Enzymes [BR:atm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ANT_22150 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     ANT_22150 (sdhA)
SSDB
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C HI0933_like DAO Pyr_redox_2 Thi4 GIDA FAD_oxidored FAD_binding_3 Trp_halogenase
Other DBs
NCBI-ProteinID: BAJ64241
UniProt: E8MY10
Position
complement(2446358..2448151)
AA seq 597 aa
MENLHQYDVIVVGGGGAGLMAAMYASRTAKTAVISKLYPVRSHTGAAQGGIGAALGNLEE
DRPEWHTFDTVKGSDYLGDQDAIEFMCNEAVQAVYDLEHMGLPFSRTADGRIAQRPFGGH
TNNVTGKPVRRSCYAADRTGHMILQTLYQQCIKNQIVFYDEFQVMDVLIRDGKVAGVVAV
ELATGELHVFQAKAVIIATGGHGRMWEITSNAYAYTGDGAAVVARRGIPLEDMEFFQFHP
TGIYKLGILITEAVRGEGGILFNAKGERFMEKYAPRIKDLASRDVVSRAMYLETRAGNDV
NGQRFFYLDVTPETVNKYAELDGRTRPDGTPYRVTAEEIRSKIPDITDFCITYLGIDPTK
QPIPVQPTAHYAMGGIPTNKFGEVVIDSNNTVLPGLYAAGEVACVSVHGANRLGTNSLVD
LIVFGKHSGLRAAEYALGADFTPLPDDPTAFVREQIERLRNGSGKERAAQIGRELRSTMF
DLVGVFRTEEGLTQAMEKIQELRARFREVRVADSGKVFNMELMQTWELGNLLDLALVTTR
SALERRESRGAHARDDYPARDDVNWLKHTLAWLEGDSVRLDYKPVVITKYQPKERTY
NT seq 1794 nt   +upstreamnt  +downstreamnt
atggaaaaccttcatcagtatgatgtgattgtggtgggtggtggtggtgccgggttaatg
gctgcgatgtatgcttcacgcacggcaaaaacggcagtgatcagtaaactctatccggtg
cgttcgcatacgggagcggcacaagggggcattggcgccgccttgggcaatctggaagaa
gaccgccctgagtggcacacctttgatacggtcaagggctcggactacctgggcgatcag
gatgccattgagtttatgtgcaacgaagccgtgcaggcagtctatgaccttgagcatatg
ggattgcctttttcccgaaccgccgatggacgtattgcgcaacgtccctttgggggacac
accaacaacgtgaccggcaagccggtgcgccgttcctgctacgccgctgaccgcaccgga
cacatgattctgcaaaccctttatcagcagtgcatcaagaaccagattgtcttctatgat
gaatttcaggtcatggatgtgctgatccgcgatggcaaggtggcgggagtggtggctgtg
gaactggcgaccggcgaactgcacgtctttcaggcaaaagccgtcatcattgctaccggc
gggcatgggcgcatgtgggaaatcacttccaacgcttatgcctacacaggcgacggcgcc
gcggtggttgcccgccgcggtattcctctggaggatatggaatttttccagttccatcct
accggcatctataaactgggcattctcatcaccgaagcggtgcgcggcgaaggggggatt
ttgttcaacgccaaaggggaacgcttcatggagaaatacgccccgcgcatcaaggatctg
gcgtcccgcgacgtggtcagccgtgccatgtatctggagactcgcgccggtaacgatgtc
aacggacagcgcttcttctacctggatgtcacccctgaaacggtgaataagtatgctgaa
ctggacgggcgtacccgcccggatggcacaccttaccgggtgactgccgaggaaatccgc
agtaagattcccgatattaccgatttctgcatcacctacctggggattgatcctaccaaa
caaccgattccggtacagccgactgcccactatgctatgggaggcattcccaccaataag
tttggcgaggtagtcattgactccaacaacactgtcttgccgggcttgtatgccgcgggg
gaggtggcttgtgtgtcagtgcatggggcgaaccgtctgggaacgaactcgctggtggac
ttaatcgtctttggcaaacattccggcttgcgcgccgccgagtacgcgctgggtgctgat
tttacacccttacctgatgatccaactgcttttgtaagggaacaaattgagcgcctgcgc
aatggcagcggtaaggaacgcgccgcacagattggacgggaactgcgctcgaccatgttt
gatttggttggtgtattccgcactgaagaaggactgacgcaggcaatggagaaaattcag
gaactgcgtgcccgcttccgcgaagtgcgggttgccgattcgggcaaggtgttcaacatg
gaattgatgcaaacctgggaactggggaacttgctggatctggcgctggtgaccacccgt
tcggcgctcgaacgtcgggaaagccgtggcgctcatgcccgcgatgattacccggcgcgg
gacgatgtcaactggttgaagcacactcttgcctggcttgagggcgactcagtgcgcctg
gattacaagcctgtggtgattaccaaataccagcctaaggagcggacttactag

KEGG   Anaerolinea thermophila: ANT_22160
Entry
ANT_22160         CDS       T01410                                 

Gene name
sdhD
Definition
(GenBank) putative succinate dehydrogenase membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
atm  Anaerolinea thermophila
Pathway
atm00020  Citrate cycle (TCA cycle)
atm00190  Oxidative phosphorylation
atm00650  Butanoate metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
atm01120  Microbial metabolism in diverse environments
atm01200  Carbon metabolism
Module
atm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ANT_22160 (sdhD)
   00650 Butanoate metabolism
    ANT_22160 (sdhD)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ANT_22160 (sdhD)
SSDB
Motif
Pfam: Sdh_cyt CybS
Other DBs
NCBI-ProteinID: BAJ64242
UniProt: E8MY11
Position
complement(2448167..2448550)
AA seq 127 aa
MTTTTRPVKVKRTFEQTAWLWMRYSAFLLIPLAWGHMILQDVVVGVHSITSEYAIQRIAN
LGWKIYDIFLLGFAFAHGMNGVRQVVRDYIRNPKTFQIVSIVLLVVWFVITLMGAIALLA
INQPIGG
NT seq 384 nt   +upstreamnt  +downstreamnt
atgacaacgacgactcgaccagtaaaagtcaaacgaacgtttgagcaaaccgcatggctg
tggatgcgttacagtgccttcctgctcatcccgttggcttgggggcatatgattctccag
gatgtggtcgtaggagtccacagcataacttcagagtatgccattcaacgtattgccaac
ctgggatggaagatttatgacattttcctgctagggtttgcctttgctcatggcatgaat
ggcgtaaggcaggtggttcgggactatattcgcaatccaaaaactttccagattgttagt
attgtcttgctggtggtctggtttgtcattaccttgatgggagccattgctttgctggcg
attaaccaacccattggaggatga

KEGG   Anaerolinea thermophila: ANT_22170
Entry
ANT_22170         CDS       T01410                                 

Gene name
sdhC
Definition
(GenBank) putative succinate dehydrogenase cytochrome b subunit
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Organism
atm  Anaerolinea thermophila
Pathway
atm00020  Citrate cycle (TCA cycle)
atm00190  Oxidative phosphorylation
atm00650  Butanoate metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
atm01120  Microbial metabolism in diverse environments
atm01200  Carbon metabolism
Module
atm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ANT_22170 (sdhC)
   00650 Butanoate metabolism
    ANT_22170 (sdhC)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ANT_22170 (sdhC)
SSDB
Motif
Pfam: Sdh_cyt Ferric_reduct
Other DBs
NCBI-ProteinID: BAJ64243
UniProt: E8MY12
Position
complement(2448560..2448997)
AA seq 145 aa
MSGGVPMSSMKTTLEGYASYRGREGHWSFLLHRITGLGVVLFLAIHIVDTSFVYFAPQLY
DEVLNVYRSTIFGLGEIALVFCLFFHGVNGLRIAYLDLFAPQNWTIEKTRRSTYVALIVT
LVLWLPSAGYMLYKLLYHNYGLFGG
NT seq 438 nt   +upstreamnt  +downstreamnt
ttgagtggaggtgtgcctatgtcatccatgaagaccaccctggagggctatgccagttac
cggggtcgggaaggtcactggtcattcctgcttcatcgtattacgggtttgggggtcgtt
ctcttcctggcgattcacattgtagatacttcgtttgtctattttgcgccgcagttgtac
gatgaggtgctgaatgtgtatcgctccaccatttttggcttgggtgaaattgccctggtg
ttctgcctttttttccatggtgtaaacgggctgcgtattgcttacctggacttatttgcc
ccgcaaaactggactatagagaagacccgccgatcgacctatgttgccctcatcgtcacc
ctggtgttgtggctgccatctgcgggctatatgctgtataagttgctgtatcacaattat
gggttgttcgggggatag

KEGG   Anaerolinea thermophila: ANT_27570
Entry
ANT_27570         CDS       T01410                                 

Gene name
sdhD
Definition
(GenBank) putative succinate dehydrogenase membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
atm  Anaerolinea thermophila
Pathway
atm00020  Citrate cycle (TCA cycle)
atm00190  Oxidative phosphorylation
atm00650  Butanoate metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
atm01120  Microbial metabolism in diverse environments
atm01200  Carbon metabolism
Module
atm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ANT_27570 (sdhD)
   00650 Butanoate metabolism
    ANT_27570 (sdhD)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ANT_27570 (sdhD)
SSDB
Motif
Pfam: Sdh_cyt CybS
Other DBs
NCBI-ProteinID: BAJ64783
UniProt: E8N140
Position
complement(3045409..3045789)
AA seq 126 aa
MTNAPLSAPKPGEGALLWAVKIFSGVLILLILILHFLVNHYWAPNGLLSHAEVVAYYQNY
PIVPIMEGFFLIFVVAHSLLGVRSILLDLRPSPRVLRGVDGMLILIGVTASVYGIWLLIR
VTGWGG
NT seq 381 nt   +upstreamnt  +downstreamnt
atgacaaacgctcccctttctgctcccaaacccggcgaaggcgcactgctctgggcggtc
aaaatcttcagcggggtgctgattctgcttatcctcatcttgcactttctggtgaatcat
tactgggcgcctaacggcttgctcagccatgccgaggtagtggcgtattaccagaattac
cccattgtaccgattatggaaggctttttcctgatttttgtggtggcgcattccctgctg
ggggtgcgttccatcctgctggatttgcgcccatctccccgcgtcctgcgcggcgtggat
gggatgttgattctgatcggcgtgactgccagcgtttacggtatctggctgttgatacgg
gtcaccggctggggcgggtag

KEGG   Anaerolinea thermophila: ANT_27580
Entry
ANT_27580         CDS       T01410                                 

Gene name
sdhC
Definition
(GenBank) putative succinate dehydrogenase cytochrome b subunit
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Organism
atm  Anaerolinea thermophila
Pathway
atm00020  Citrate cycle (TCA cycle)
atm00190  Oxidative phosphorylation
atm00650  Butanoate metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
atm01120  Microbial metabolism in diverse environments
atm01200  Carbon metabolism
Module
atm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ANT_27580 (sdhC)
   00650 Butanoate metabolism
    ANT_27580 (sdhC)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ANT_27580 (sdhC)
SSDB
Motif
Pfam: Sdh_cyt Fumarate_red_C
Other DBs
NCBI-ProteinID: BAJ64784
UniProt: E8N141
Position
complement(3045800..3046192)
AA seq 130 aa
MNEPKKLHSRGVLDWFDPRGRQVGGWGFIINRISAIGLTVYLYLHLVMLGKLAQGPESFD
AFIATAKQPLILFGELLVIIAGLYHGLNGIRIALTSFGVAVRYQRALLIGVVLLTAAGSL
FFAIRMLSIH
NT seq 393 nt   +upstreamnt  +downstreamnt
atgaacgaacccaagaaattgcattcccgcggcgtgctggactggtttgacccgcgcggc
aggcaggtgggtggctggggcttcatcattaaccgcatcagcgccatcgggctgaccgtg
tacctctacctgcatctggtcatgctgggcaaactggcacagggacccgagtcgttcgat
gcctttatcgctactgccaaacaaccgctcatcctctttggcgaactgctggtcatcatt
gccggactgtaccacggcttgaacggcatccgtattgccctgaccagttttggcgtggcg
gtgcgctatcagcgcgctctgctcatcggcgtggtgctgttgaccgcggcagggtcgctg
ttcttcgccatccgcatgctcagcatccattga

KEGG   Anaerolinea thermophila: ANT_27590
Entry
ANT_27590         CDS       T01410                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
atm  Anaerolinea thermophila
Pathway
atm00020  Citrate cycle (TCA cycle)
atm00190  Oxidative phosphorylation
atm00650  Butanoate metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
atm01120  Microbial metabolism in diverse environments
atm01200  Carbon metabolism
Module
atm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ANT_27590 (sdhB)
   00650 Butanoate metabolism
    ANT_27590 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ANT_27590 (sdhB)
Enzymes [BR:atm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ANT_27590 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     ANT_27590 (sdhB)
SSDB
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_9 Fer4_10 Fer4 Fer4_17 Fer2 Fer4_2 Fer4_4 Fer4_16 Fer4_18 Fer4_21 Fer4_6 Fer4_3
Other DBs
NCBI-ProteinID: BAJ64785
UniProt: E8N142
Position
complement(3046210..3046959)
AA seq 249 aa
MSDEKWTVTFTVYRKKDEQPARYDTFTLEVSPDEYVLDAVERIWAFHDRSLVFAHACHHS
TCGACGMRVNGVERLTCITPIREVTRNGGTVRVEPLRNFPVVSDLAVDMSRLYRAMDAVQ
APAVHPLDAAPLEGGGIRPPREVPQPEDEGEFYRLADCIECGLCVSACPVAGTDPTYLGP
AALAGAQLQGVAQNPDLLGVVDCAEGVWRCHSAYECTAVCPSNVQPGWRIMDLRRQVVAQ
RIKALFGKG
NT seq 750 nt   +upstreamnt  +downstreamnt
atgagtgatgaaaagtggactgtaacctttaccgtgtaccgcaagaaggatgaacagcct
gcgcggtacgatacttttacactggaagtaagccccgatgagtacgttctggatgcggtg
gaacgtatctgggcttttcacgaccgctcgctggtgtttgcccatgcctgtcaccattcc
acctgcggcgcctgcgggatgcgcgtcaatggggtggagcgcctgacctgcatcaccccc
atccgtgaggtcacccgcaacggcggcacggtgcgtgttgagcctctacgcaatttcccc
gtggtcagtgacctggcggtggatatgagccggctgtaccgcgccatggatgccgtgcag
gctccggcggtgcatccgctggacgccgcgcctctggagggcgggggcatccgcccgccg
cgcgaagtccctcagcccgaagacgaaggcgagttttaccgccttgccgactgcattgag
tgcggcttgtgcgtgagcgcctgtccggtggcaggtactgacccgacgtatctgggtccg
gcggcgctggcaggtgcgcaattgcagggcgttgcccaaaaccccgatttgcttggcgtg
gtggactgcgccgagggggtatggcgctgtcacagtgcctatgagtgtacagcggtttgc
ccgtccaacgtccagcccggctggcgcatcatggatttgcgccgtcaggtggtggcacag
cgcatcaaagccctgtttggaaaaggttaa

DBGET integrated database retrieval system