KEGG   Anaerolinea thermophila: ANT_26710Help
Entry
ANT_26710         CDS       T01410                                 

Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
atm  Anaerolinea thermophila
Pathway
atm00010  Glycolysis / Gluconeogenesis
atm00030  Pentose phosphate pathway
atm00051  Fructose and mannose metabolism
atm00680  Methane metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
atm01120  Microbial metabolism in diverse environments
atm01130  Biosynthesis of antibiotics
atm01200  Carbon metabolism
atm01230  Biosynthesis of amino acids
Module
atm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:atm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANT_26710
   00030 Pentose phosphate pathway
    ANT_26710
   00051 Fructose and mannose metabolism
    ANT_26710
  Energy metabolism
   00680 Methane metabolism
    ANT_26710
Enzymes [BR:atm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     ANT_26710
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     ANT_26710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: BAJ64697
NITE: ANT_26710
UniProt: E8N0E8
Position
2947509..2948627
Genome map
AA seq 372 aa AA seqDB search
MSEKLTLSVIKADVGGFVGHSAIHPDLIDTARMALEEARQKGWLIDFHVTACGDDLQLIM
THSRGVDDVEIHHLAWQVFERCTAIARKLKLYGAGQDLLTDAFSGNVRGMGPGVAEMELH
ERESEPVIIFMADKTSAGAWNLPLFRMFADPFNTAGLVISPSMHEGFRFEVHDVKQHKRI
FFDTPAEMYDLLVFIGASGRYVIKAVYTRDGEIGAVSSTQRLALIAGKYVGKDDPVCIVR
SQGKFPAVGEVLEPFTMPHIVEGWMRGSHYGPLMPVPVRQATPSRFDGPPRVAALGFQLA
NGGLIGPRDLFDDPGFDEVRRQVNVLADQLRRHGAFEPHRLPMDEMEYTTLPQVMEKLAE
RWEALPDEPVSV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaaaactcactctgagcgtgattaaagccgatgtaggcggttttgtgggacat
tctgccattcatcccgacctgatcgataccgcccgcatggctcttgaggaagcccggcag
aagggctggctgatcgacttccatgtcaccgcctgcggagacgacctgcagttaatcatg
actcactcccgcggcgtggatgacgtggaaattcaccatctggcatggcaggtcttcgag
cgctgtaccgctattgccaggaaattgaaactctacggcgcaggacaggacctgctcacc
gatgccttctcgggcaacgtacgcggcatgggacccggtgtggcggagatggaactgcac
gaacgcgaatctgaaccggtcatcatcttcatggcagataagacctcagccggtgcctgg
aatctcccattgttccgcatgtttgccgaccccttcaacaccgccgggctggtgatttct
cccagcatgcacgaaggcttccgctttgaggtacacgatgtgaaacagcacaaacgcatc
ttctttgacacccccgccgagatgtacgacctgctggtgttcatcggcgcgtccggacgc
tatgttatcaaggcggtgtacacccgcgatggcgagattggcgcggtttcgtccacccag
cgcctggcattgattgccggcaagtacgtgggcaaggatgacccggtgtgcatcgtacgc
agtcagggcaagtttcccgcagtgggcgaagtactggagcctttcaccatgccgcacatc
gtggaaggctggatgcgcggctcgcactacggaccgctgatgcccgtgccggtacgtcag
gcaacccccagccgctttgacggtccgcccagggtggcggcgctgggcttccaactggca
aacggcggactcatcggcccgcgcgatttattcgacgacccgggttttgatgaagtgcgc
cgtcaggtcaacgtgctggcagatcaactgcgccgccatggcgctttcgaaccgcaccgc
ctgccgatggacgaaatggaatacaccaccctgccgcaggtgatggaaaaactggcagaa
cgctgggaagccctgcccgatgagccagtgagtgtgtaa

DBGET integrated database retrieval system