KEGG   Anaerolinea thermophila: ANT_28320
Entry
ANT_28320         CDS       T01410                                 

Definition
(GenBank) putative pyruvate:ferredoxin oxidoreductase
  KO
K03737  pyruvate-ferredoxin/flavodoxin oxidoreductase [EC:1.2.7.1 1.2.7.-]
Organism
atm  Anaerolinea thermophila
Pathway
atm00010  Glycolysis / Gluconeogenesis
atm00020  Citrate cycle (TCA cycle)
atm00620  Pyruvate metabolism
atm00650  Butanoate metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
atm01120  Microbial metabolism in diverse environments
atm01200  Carbon metabolism
Module
atm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANT_28320
   00020 Citrate cycle (TCA cycle)
    ANT_28320
   00620 Pyruvate metabolism
    ANT_28320
   00650 Butanoate metabolism
    ANT_28320
Enzymes [BR:atm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     ANT_28320
    1.2.7.-  
     ANT_28320
SSDB
Motif
Pfam: POR_N POR EKR PFOR_II Fer4_16 TPP_enzyme_C Fer4_7 Fer4 Fer4_6 Fer4_21 Fer4_9 Fer4_10 Fer4_2 Fer4_17 Transketolase_C Fer4_15 Fer4_4 Fer4_8 Fer4_13 Fer4_3
Other DBs
NCBI-ProteinID: BAJ64858
UniProt: E8N1B5
Position
complement(3128024..3131596)
AA seq 1190 aa
MSNRQKITLDGNEAVARVAYRASEVIAIYPITPSSAMGEWSDEWMAKKVKNLWGTVPLVV
EMQSEGGAAGAVHGALQSGALSTTFTASQGLLLMIPNMYKIAGELTPLVIHVSARALAAQ
ALSIFGDHSDVMATRQTGFALLASRSVQEAHDMALIAHAATLEARVPFLHFFDGFRTSHE
VQKIEELTEDDMRAMISDELIAEHRKRALSPDHPVLRGTAQNPDVYFQGRETVNPFYART
PEIVQKTMDRFAQLTGRAYHLFEYAGAPDAERVIVLMGSGAETAEETAKYLVERGEKVGV
VTVHLYRPFSAKHLLAALPATTKAIAVLDRTKEPGSAGEPLYQDVVTAVTEGLAGGFAPF
KTLPTMIGGRYGLSSKEFTPGMVKAVFDELKKSQPKNHFTVGIVDDVSFTSLDYDPDFEI
LDSSTVQCVFFGLGSDGTVGANKNSIKIIGEETENNAQGYFVYDSKKSGSVTISHLRFGP
KPLRAPYLIRQADFVACHQFSFLERLDITRYAKPGAVFLLNSIYGPDEVWNHLPREVQKD
IIEKKLKFYVIDAYEVANRTGMGQRINTIMQTCFFAISGVLPREQAIAEIKKAIQKTYGK
RGEAVVQKNFEAVDQTLANLYEVKVPDQVTSTFSRRPAVGPEAPEFVRDVLAPMMVFEGD
NLPVSAMPVDGTFPTATAQYEKRNIALEIPVWEPDLCIQCGKCAMVCPHAVIRMKVYEPE
LLANAPATFKSIDAKFKEFPNTKFTIQVAPEDCTGCALCVEACPAKDKTQAGRKAINMAP
QPPIREQERENWNFFLSLPDVDPTAVAPTTVKNSQLLRPLFEFSGACAGCGETPYVKLLS
QLFGERAVIANATGCSSIYGGNLPTTPWAKNAEGLGPAWSNSLFEDNAEFGLGFRLTIDK
LNEYARELLTDLSGLVGSDLSAAILEADQSTEAGVREQRKRVAALKEILKGIKDPRAFNL
LNVADYLVRKSVWIVGGDGWAYDIGYGGLDHVLASGRNVNILVLDTEVYSNTGGQASKST
PRAAVAKFAMSGKGLPKKDLGMIAMSYGYVYVARVAMGANDQQTLRAFLEADAYEGPSLI
IAYSHCIAHGIDMRKGLDQQKLAVNSGVWPMYRYNPMLALEGKNPLIIDSKDPSVDVQEY
AYNETRYRMLVQADEARAEMLMQQAREDARKRWELYKQMAAIQYKSNGND
NT seq 3573 nt   +upstreamnt  +downstreamnt
atgagcaatcgtcaaaaaattactttggatggcaatgaggcggttgcgcgggtggcctac
cgcgccagcgaggtcattgccatttaccccattaccccttcttccgccatgggagaatgg
tcagatgaatggatggcgaagaaggtcaagaatctgtggggcaccgtaccgctggtggta
gaaatgcagtccgagggcggcgcggcaggcgcggtgcacggcgctctgcaatcgggggcg
ctttccactacctttaccgcctctcagggcttgctcttgatgattcccaatatgtacaaa
attgccggtgaactcaccccgctggtgattcacgtttcggcgcgtgcgttggcggcgcag
gcgctttccattttcggtgaccactccgacgtgatggcgacccgtcagactggctttgcc
ttgctggcatcccgctcggtgcaggaagctcacgacatggcgttgattgcccacgccgcc
acgctggaagcccgtgtgcctttccttcacttcttcgacggtttccgcacctctcatgaa
gtgcagaagattgaagaactcaccgaagacgacatgcgcgcgatgatttccgatgaactt
atcgctgaacaccgcaagcgtgcgctcagccccgatcatcccgttctgcgcggcacggcg
cagaaccccgatgtgtacttccagggacgtgagacggtcaaccccttctacgcccgcacg
ccggaaatcgttcagaagaccatggatcgctttgcccaactgaccgggcgcgcctatcat
ctctttgaatatgctggtgcaccggatgctgagcgtgtcattgtcctgatgggctcgggt
gccgaaactgccgaggaaaccgccaaatacctggtggaacgcggtgaaaaggtcggtgtg
gtgaccgtacacctgtaccgccccttctctgccaaacacctgctggcggcgctccctgct
accaccaaagccatcgctgtcctcgaccgcaccaaagagcccggttcggcgggtgaaccg
ctctatcaggacgtggttaccgccgtcaccgaagggctggcgggtggctttgcccccttc
aagaccctacccaccatgataggtgggcgctatggcttgtcttccaaagagttcacccct
ggcatggtcaaagccgtctttgacgaactcaagaagagccagcccaagaatcacttcacc
gtgggtatcgtggatgatgtgtccttcaccagtctggattatgaccccgactttgaaatc
cttgactcctcaaccgtgcagtgcgtcttcttcggtttgggctccgatggcacggtgggt
gccaataagaactccatcaagattatcggcgaagaaaccgagaacaacgctcagggctac
tttgtgtacgactccaagaaatccggctcggtgaccatttcgcacctgcgctttggtccc
aagcccctgcgcgctccctacctgattcgccaggcagatttcgtggcttgccaccagttc
tccttcctggagcgcctggatatcacccgctacgccaaacccggcgcggtcttcctgctc
aacagtatttacggaccggatgaggtctggaatcacctgccgcgcgaggtgcagaaggac
atcatcgaaaagaaactgaagttctacgtcatcgacgcttacgaagtggcgaaccgcact
ggcatggggcagcgcatcaacaccatcatgcagacctgcttctttgccatctccggcgtc
ctgccgcgcgaacaagccatcgccgagattaagaaagccatccagaagacctacggcaag
cgtggcgaagccgtggtgcagaagaactttgaagccgtggatcaaaccctggcaaacctg
tatgaagtgaaagtccccgatcaggtgaccagcaccttcagccgccgcccggcagttgga
cccgaagcgcctgaattcgtgcgcgacgtgctggcgccgatgatggtctttgagggcgat
aacctgcccgtctctgccatgccggtggacggcactttccccaccgccacggcgcagtat
gaaaaacgcaacatcgctctggaaatcccggtgtgggagcctgatttgtgcatccagtgc
ggtaaatgtgccatggtatgtccgcacgccgtcatccgcatgaaggtgtacgaaccggaa
ctgctggcaaacgccccggcgaccttcaagtctatcgacgccaaattcaaggaattcccc
aacaccaagttcaccattcaggtagcgccggaagactgcaccggatgcgcactgtgcgtg
gaagcctgccccgccaaggacaagacccaagcaggacgcaaagccatcaacatggcgcct
cagccgcccatccgcgagcaggaacgcgaaaactggaacttcttcctcagcctgccggat
gtggatccgactgcggttgcgcccaccacggtcaaaaattcgcagttactgcgcccactg
ttcgaattctccggcgcctgcgccggctgtggcgagacgccctacgtcaaactgctttcg
cagttgtttggcgagcgcgccgtgattgccaacgccaccggctgttcctcgatttacggc
ggcaacctgcctaccaccccgtgggcaaagaatgccgaaggactcggtcccgcctggtcc
aactcgctctttgaagacaacgccgagttcggtttgggcttccgcctgaccatcgacaaa
ctcaacgagtacgcccgcgaactgctgacagacctctccggactggtgggcagtgacctg
agcgccgccattctggaagccgatcaaagcaccgaagcgggtgtgcgcgaacagcgcaag
cgcgttgccgcgctgaaggaaatcctcaagggcattaaagacccgcgcgccttcaacctg
ctcaacgtggcagattacctggtgcgtaagagcgtgtggattgtcggcggtgacggttgg
gcatacgatatcggctacggcggtctggatcatgtgctggcgtccgggcgcaatgtcaat
atcttggtgctggataccgaggtgtactccaacaccggcggtcaggcatccaagtccacc
ccgcgcgcggcggttgccaagtttgccatgagcggtaagggcttacccaagaaggacctg
gggatgattgccatgtcctatgggtatgtgtacgtggcacgcgttgccatgggggctaac
gaccagcagaccctgcgcgccttccttgaggcggatgcctacgaaggtccttcgctgatt
attgcctacagccactgtatcgcgcacggcatcgacatgcgcaaagggctggaccagcag
aaactggcggtcaactccggcgtctggcccatgtaccgctacaaccccatgctggcactg
gaaggcaagaacccgctcatcattgactccaaagacccctcggtggacgtacaggaatac
gcctacaacgagacccgctaccgcatgctggttcaggcggacgaagcccgcgccgaaatg
ctgatgcaacaggcccgcgaagatgcccgcaagcgctgggaactctacaagcaaatggca
gccattcaatataagtccaacgggaacgactaa

DBGET integrated database retrieval system