KEGG   Anaerolinea thermophila: ANT_30960
Entry
ANT_30960         CDS       T01410                                 

Definition
(GenBank) class-I fumarase family protein
  KO
K01676  fumarate hydratase, class I [EC:4.2.1.2]
Organism
atm  Anaerolinea thermophila
Pathway
atm00020  Citrate cycle (TCA cycle)
atm00620  Pyruvate metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
atm01120  Microbial metabolism in diverse environments
atm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ANT_30960
   00620 Pyruvate metabolism
    ANT_30960
Enzymes [BR:atm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     ANT_30960
SSDB
Motif
Pfam: Fumerase BppU_IgG
Other DBs
NCBI-ProteinID: BAJ65122
UniProt: E8N2X2
Position
3441695..3442576
AA seq 293 aa
MEHLKEPLIELIRLAATNLPPDVEKALRQALEREEPGSAARGALETILKNVELARKRSTP
ICQDTGTPIFYVYHPEGWSTRKLRQVIEEAVAEATKRSYLRPNSVDSLTEKNTGNNLGDE
HFPTIHFEEVDGDTLTVDLMLKGGGCENVGAQYSLPGRVGGGVPAGRDLEGVRRVVLDAV
HKAQGQGCSPGILGVAIGGDRGSGYYASKEVLFNELDNPNPDPELEKLEERITEEANQLG
IGPMGFGGNTTVLDTKITGLHRLPASFFVTVSYMCWAYRRRRMIWKDGTAVYK
NT seq 882 nt   +upstreamnt  +downstreamnt
atggaacatcttaaagagcctttgattgaattgattcggctggcggcaaccaacctgccc
cccgatgtggaaaaggcgctccgtcaggcattggagcgcgaagaacccgggtcggcggca
cgcggcgcgctggaaactattttgaaaaatgtagaactggcacgcaaacgctccacaccg
atttgtcaagataccggtaccccgattttttacgtgtatcaccctgaagggtggtccacc
cgcaaactgcgccaggtgattgaagaagccgtagccgaagccaccaaacgctcgtatttg
cgccccaactcggtggattcactcaccgagaagaacaccggtaacaacctgggcgatgaa
cactttcccaccatccactttgaagaggtggacggtgacaccctcaccgttgacctgatg
ctcaaaggcggcggttgcgagaacgttggcgcacagtactctctgcccgggcgtgtgggc
ggcggagttcctgccgggcgcgacctggaaggggtgcgtcgtgtggtgctggatgctgta
cacaaagcccaggggcagggctgttcgccgggcatccttggcgttgccatcggcggcgac
cgcggctcaggatactacgcctcgaaagaggtcctcttcaacgaattggacaaccccaac
ccggacccggaactggaaaaactggaagaacgcatcaccgaggaagccaatcagttaggc
atcggtccgatgggctttggcggcaacaccaccgtgctggataccaaaatcaccggttta
caccgcctgcctgccagtttcttcgtcaccgtgtcgtacatgtgctgggcgtaccgccgc
cgccgaatgatctggaaagacggcaccgctgtgtacaagtaa

KEGG   Anaerolinea thermophila: ANT_30970
Entry
ANT_30970         CDS       T01410                                 

Definition
(GenBank) class-I fumarase family protein
  KO
K01678  fumarate hydratase subunit beta [EC:4.2.1.2]
Organism
atm  Anaerolinea thermophila
Pathway
atm00020  Citrate cycle (TCA cycle)
atm00620  Pyruvate metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
atm01120  Microbial metabolism in diverse environments
atm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ANT_30970
   00620 Pyruvate metabolism
    ANT_30970
Enzymes [BR:atm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     ANT_30970
SSDB
Motif
Pfam: Fumerase_C
Other DBs
NCBI-ProteinID: BAJ65123
UniProt: E8N2X3
Position
3442589..3443218
AA seq 209 aa
MKKVQIPISDDVVRSLKVGDPLALSGVMVTARDAGHKWLIDTFVTRKREPQGDDLEVYEA
LKKLLNGGVIYHCGPVVAGLDTREYRFVAAGPTTSIREEPYQGDIMRHFNVKGVIGKGGM
GAKTLQACQEVPGLYLHAVGGAATWIAQTVKRVLGVYKLEFGVPEAFWVIEVEDFPVVVT
MDANGNSLHAEIEARSAKVLENLLTGEKS
NT seq 630 nt   +upstreamnt  +downstreamnt
atgaagaaagtacagattcccatttccgacgatgtggtgcgctcgttgaaagtaggcgat
cctcttgctctttccggagtgatggtcaccgcgcgcgatgccggacataaatggctgatc
gataccttcgtcacccgcaagcgcgagccgcagggtgatgatttagaggtttacgaagcc
ctgaagaaactgctcaatggcggggtgatttaccactgtggaccggtggttgccggactg
gatacccgcgagtaccgatttgttgccgccggtcccaccaccagcatccgcgaagaaccc
tatcagggcgatatcatgcgccacttcaacgtgaaaggcgtcatcggcaagggcggtatg
ggcgccaaaactctgcaagcctgccaggaagttccaggactgtacctgcatgcggtgggc
ggcgcggctacgtggattgcgcagaccgtcaagcgcgtgctgggcgtttataaactggag
tttggcgttcctgaagccttctgggtcatcgaagtggaagacttcccggtcgtggtgacc
atggacgccaacggaaacagcctgcacgccgaaatcgaagcgcgctcggcaaaggtactg
gaaaatctgttgacgggcgagaaatcctga

DBGET integrated database retrieval system