KEGG   Acetobacter tropicalis: CIW82_00210Help
Entry
CIW82_00210       CDS       T05181                                 

Definition
(GenBank) propionyl-CoA--succinate CoA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
ato  Acetobacter tropicalis
Pathway
ato00020  Citrate cycle (TCA cycle)
ato00620  Pyruvate metabolism
ato00650  Butanoate metabolism
ato01100  Metabolic pathways
ato01110  Biosynthesis of secondary metabolites
ato01120  Microbial metabolism in diverse environments
ato01130  Biosynthesis of antibiotics
ato01200  Carbon metabolism
Module
ato_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ato_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ato00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CIW82_00210
   00620 Pyruvate metabolism
    CIW82_00210
   00650 Butanoate metabolism
    CIW82_00210
Enzymes [BR:ato01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     CIW82_00210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans
Motif
Other DBs
NCBI-ProteinID: ATJ89372
UniProt: A0A291PD23
Position
complement(40901..42412)
Genome map
AA seq 503 aa AA seqDB search
MTTERIGYHAFRDRVMTADEAARLIADKETIATSGFGAGGTPKAVPRALAAMAKERHAQG
EPFALRLFTGASTMTDVDGVLADADAVSFRMPYMSDPIMRKKINAGSITYVDTHLSRVAS
WARAGFFGKIDVAIIEVALVRADGGFVPTFAIGNAQTWLDLADRVIIEINTWHTPQIEGL
HDIWNTTAPDAAATLARIATPGTRVGQAVLHVDPDKVAAVVFTHEAEQSITFRSDPDAAI
IAGHILDFLQNEVARGRLPRALPPLQSGVGNIANAVMGGLANAPFENLTAYTEVIQDGML
DMLRSGRMAAISGAALYLSPACADFANTQMHSLRDRIVLRPQEVSNNPSVVRALNAIAMN
AAIEIDIYGNVNSTRVAGSRVQNGIGGSGDFARSAILSIFMTPSIAKNHDISSIVPMVSH
VDHISQDVQVVVTEQGLADLRGLGARDRARQIITHCAHPAYRPLLLDYMQRAERQPGGDT
PHILSEALSWHQRLMDTGVMMPR
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagaacggatcggataccacgcgttccgcgacagggtgatgaccgccgatgag
gccgcccggctgatcgcggacaaggagacgatcgccaccagcggtttcggggcagggggc
acgcccaaggccgtgccgcgcgcccttgctgccatggcgaaggaacgccatgcgcagggt
gaaccgtttgcgctcaggctgttcaccggggcctctaccatgaccgatgtcgatggcgtg
ctggcggatgcggatgcggtcagtttccgcatgccttatatgagcgacccgatcatgcgc
aaaaaaatcaacgccggcagcattacctatgtcgatacgcatctcagccgcgtggcgtct
tgggcccgggcaggctttttcggcaagattgacgtggcaatcatcgaggtcgcactggtg
cgcgccgatggtgggttcgtgcccacctttgcgatcggtaacgcacagacctggcttgat
ctggccgacagggtaattatcgagatcaatacgtggcacacgccccagatcgaagggctg
cacgatatctggaacaccaccgccccggatgccgccgcaaccctcgcacggatcgcaaca
cccggcacgcgtgtgggccaggcggtcctgcatgtggaccccgacaaggtcgcggcagtc
gtgttcacgcatgaagccgagcagagcatcacgtttcgctcggacccggatgcggcgatc
attgctgggcatattcttgattttcttcaaaacgaggttgcgcgcggtcgtctgccacgc
gccctgccacctttgcaatcgggtgtcggcaatatcgccaacgcggtcatgggcgggctg
gccaatgcgcccttcgagaatctgaccgcctatacggaagtcattcaggacggcatgctg
gacatgctgcgcagtggtaggatggcagccatttcaggggcagccctttacctgagcccc
gcctgcgcggatttcgcaaatacgcagatgcacagcctgcgtgacaggattgtcctgcgc
ccacaggaggtcagcaacaatccttccgtcgtgcgcgccctgaacgccattgccatgaat
gcggcgattgagatcgatatctacggcaatgtcaattcgacccgggtcgcggggtcgcgc
gtgcagaacgggatcggcggctcgggcgattttgccagaagtgcgatactgtcgattttc
atgacaccctcaattgcgaaaaatcacgatatttcttcaatcgttcctatggtgtcccat
gtcgatcatatcagccaggacgttcaggtggtggtaacggaacagggcctggccgatctg
cgcgggctaggcgcgcgggacagggcgcgccagatcatcacccactgtgcccatcccgcc
taccgcccattgctgctggactatatgcagcgcgccgaacgccagcctggtggagatacg
ccgcatatcctgtccgaggcgctttcatggcatcaacgtctgatggatacgggcgtcatg
atgccccggtga

DBGET integrated database retrieval system