KEGG   Acetobacter tropicalis: CIW82_03425Help
Entry
CIW82_03425       CDS       T05181                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
ato  Acetobacter tropicalis
Pathway
ato00860  Porphyrin and chlorophyll metabolism
ato01100  Metabolic pathways
ato01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ato00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CIW82_03425 (hemN)
Enzymes [BR:ato01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     CIW82_03425 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: ATJ89886
UniProt: A0A291PEM3
Position
complement(750199..751578)
Genome map
AA seq 459 aa AA seqDB search
MSAASSSDLVHRYGGNLPRYTSYPTAASFSEAVGPAQAESWLRALPAQQPVSLYFHVPFC
DELCRFCGCNTSVMRHEDGRLAYGDLLREELRRVVALVGTRRSVKHVQFGGGTPSTLPAS
ALRQIMRSVRSMFQIEPDAELSMELDPRHVPVGYPALLGDLGFTRISLGVQDLNPQVQDA
CGRHQSFEQTEACVTAVRNAGVSGVNIDLIYGLPYQTEESVAETARRIASLRPDRLAVFG
YAHVPWKQKRQRLIPEESLPKPSERLAQRARMDTVLRAEGYLPVGLDHYALPQDALVQAA
STGTLRRNFQGYTTDSCDVLLGMGASAISMLPDGYVQNITAVAPYARAMADHDGLPIARG
VERTADDRLRGSLIERLMCDMGVDLEQMEAQLDVFSPELGALEPLIQDGLVTVEGPKITV
TEKGRPFLRHVAAVFDTHRKTLSQAPSSGAPQPRFAGAL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggcatcttcttcagatctggttcaccgttacggcgggaacctgccgcgctat
accagctacccgactgccgccagtttttctgaggcagtcggccccgcgcaagcagaaagc
tggctgcgcgcccttccggctcagcagccggtttctctctatttccatgttcctttctgt
gatgagctgtgccgtttttgtgggtgcaacacatccgtcatgcggcatgaagacgggcgt
ctggcctacggtgatcttctgcgggaagaattacgccgtgttgttgcgctggttggaacg
cggcgtagtgtaaaacatgtgcagtttggcggcggcaccccttccacactccccgcatcg
gctttgcggcagatcatgcggtctgtgcggtccatgttccagattgagcctgatgccgaa
ctgtccatggagcttgatccacgccatgtgcccgtaggttatccggctcttctgggtgat
ctgggcttcacgcggatcagcctcggtgtgcaggatctgaaccctcaggtgcaggatgcc
tgtggccgccatcagtcttttgaacagacagaagcctgcgttaccgctgtacggaatgca
ggggtgtctggcgtcaatattgatctgatctatggcctaccataccagacagaagaaagt
gtcgcagaaaccgcgcgcaggattgcgtctttgcgtccggatcgtctggccgtgttcgga
tacgctcatgtgccctggaaacagaaacgtcagcggctgatccctgaagagtctcttccc
aagccatccgaacgtcttgcccagcgggcccgtatggataccgtgttacgggcggagggc
tatctgccggtcggtctggatcattacgcgctgcctcaggatgcgctggtgcaggccgca
tcaacaggcacgcttcgtcgtaattttcagggttatacgaccgattcgtgcgatgttctg
ctgggtatgggggcctccgccatttccatgctgcccgatggatacgtgcagaatattacc
gcagtcgcgccttatgctcgggccatggcggatcatgatggtctgcccatcgcgcggggt
gtggagcgcacggctgatgatcggctgcgaggcagtctgatagaacggctgatgtgcgat
atgggcgttgatctggaacagatggaagctcagcttgatgtcttctcgccggagctaggt
gcgcttgaaccgttgattcaggatggactggtaacggtggaaggccccaaaatcacagtg
acagaaaaaggacggccttttttgcgtcatgtggcggccgtgtttgatacccaccggaaa
accttgtctcaggcgccttctagcggggcaccccagccgcgttttgcgggcgcgctctga

DBGET integrated database retrieval system