KEGG   Acetobacter tropicalis: CIW82_07280Help
Entry
CIW82_07280       CDS       T05181                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ato  Acetobacter tropicalis
Pathway
ato00260  Glycine, serine and threonine metabolism
ato01100  Metabolic pathways
ato01110  Biosynthesis of secondary metabolites
ato01120  Microbial metabolism in diverse environments
ato01130  Biosynthesis of antibiotics
ato01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ato00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CIW82_07280
Enzymes [BR:ato01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CIW82_07280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ATJ90516
UniProt: A0A252A3Z8
Position
1593067..1594098
Genome map
AA seq 343 aa AA seqDB search
MSVSQQFASDNYAGICPEAWQAMQQANEGSLTAYGEDEWTTRAANAFRTLFETDCEVFFA
FNGTAANSLALAALCQSYNSVICSSFAHVETDECGAPEFFSNGSKLLVARTENAKLTPQD
VRTLATCRTDIHYPKPRAVTITQPTETGELYTIEEISALSATCRELGLRLHMDGSRFANA
CAALGCTPADMTWKAGVDVLCFGGTKNGMAVGEAILFFDHALAEGFDYRCKQAGQLASKM
RFLSAPWVGLLESGAWLRNGAYGNSCALRLAHAVRDVPGLELMFPVQSNAVFLRAPEKVF
IALQERGWRFYTFIGGGARFMFAWDADPARVDELAADLAACSV
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgagccaacaatttgcaagtgataactacgccggaatctgcccggaagcgtgg
caggccatgcaacaggccaacgagggctctctcaccgcctatggcgaggacgagtggaca
acccgcgccgccaacgccttccgcaccctgtttgaaacagattgcgaggtctttttcgcc
ttcaacggcaccgctgcaaattcgctggcgctggccgcattatgtcagtcctataacagc
gtgatctgttcttctttcgcccatgtggaaacggatgaatgtggcgcgccggagttcttt
tccaacggctccaagctgctggtcgcccgcacggaaaacgccaaactcaccccgcaggat
gtgcgcacgcttgccacctgccggacagatatccactaccccaagccgcgcgccgtcacc
atcacccagcctacggaaacgggtgaactctacacgatagaggaaattagcgccctttcc
gccacctgccgggaactgggcctgcgcctgcacatggatggctcccgcttcgccaatgct
tgcgccgcccttggctgtaccccggccgacatgacatggaaagcaggcgtggatgtgctg
tgttttggcggcacaaagaacggcatggccgtgggtgaggccattctgttctttgaccat
gctttggccgaagggtttgattaccgctgcaagcaggccgggcaactggcctccaaaatg
cgtttcctgtctgctccatgggttggcctgctggaaagcggagcatggctgcgcaatggt
gcgtatggcaatagctgcgcgctccgtctggcccatgccgtgcgtgatgttccggggctg
gaactgatgtttccggtgcagtccaatgccgttttcctgcgtgcgccggaaaaggtgttc
atcgccctgcaggaacgcggctggcgcttctatacctttattggcggcggcgcgcgtttc
atgttcgcgtgggatgcagaccccgcccgtgtggatgaactggcggctgatcttgctgcc
tgtagtgtatga

DBGET integrated database retrieval system