KEGG   Acetobacter tropicalis: CIW82_12610Help
Entry
CIW82_12610       CDS       T05181                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ato  Acetobacter tropicalis
Pathway
ato00450  Selenocompound metabolism
ato00970  Aminoacyl-tRNA biosynthesis
ato01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ato00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CIW82_12610
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CIW82_12610
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ato01007]
    CIW82_12610
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ato03016]
    CIW82_12610
Enzymes [BR:ato01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CIW82_12610
Amino acid related enzymes [BR:ato01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CIW82_12610
Transfer RNA biogenesis [BR:ato03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CIW82_12610
 Prokaryotic type
   Other AARSs
    CIW82_12610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ATJ91400
UniProt: A0A291PIU4
Position
2740041..2741585
Genome map
AA seq 514 aa AA seqDB search
MTGRFYVTTPIYYVNGAPHIGHAYTSVAADVMARFHRLAGGEVFFLTGTDEHGQKVEQAA
QAAGIDPKVFVDRVSADFRNMADAMAISYDDFIRTTEPRHITGAQALWQKVAESGAIYLG
AYEGWYALRDECFYGEDELIDGPEGKKVAPTGAPVDWVKEPSYFFKLSAFQDKLLELYES
HPDFLGPNSTKREIVSFVKQGLRDLSISRTSFKWGIPVPGDEAHVMYVWFDALANYLSAL
DYPNPDAPRAAFWPANLHLVGKDIARFHAIYWPAFLMAAGIEVPKKIFANGWWTIEGQKM
SKSLGNVVDPRDLAKEFGLDAVRFFLLREVPFGGDSDLSRKSLITRNNVELANDLGNLCQ
RTLSLVARNCDGIIPERRALTEADTHLLGQVSVLPELMAAQLERCALTDALEDVWKVIRA
GNAYIDHQAPWALRKTDIERMQDVLRVLLDALRGIATVLQPFMPQSMDRMLTQLGVEDGE
RTFASLEILLPAGRKLPAPQGIFPRYVEPTAEPS
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaccggccgtttttatgtcacgaccccaatctattacgtgaatggcgccccccatatc
gggcacgcctatacctccgttgcggcggacgtcatggcgcgttttcaccggctggcgggg
ggcgaggtcttttttctgaccggaacggacgagcacggccagaaggtggaacaggctgca
caggcagcaggtattgaccccaaagtttttgtggaccgcgtttccgcggatttccggaac
atggcggatgccatggccatctcctatgatgacttcattcgcacaacggaaccgcgtcat
attaccggtgcgcaggctctttggcagaaagtggcggaaagtggtgccatctatctgggg
gcttatgagggatggtatgctcttcgggatgagtgtttctacggtgaagatgaactgatt
gatgggccggagggcaagaaagttgctcctaccggcgcacctgtcgattgggtgaaggag
ccctcctattttttcaagctgtcagcatttcaggacaaattgctggaactgtatgaaagt
catcctgactttctaggccccaacagcaccaagcgcgagattgtcagcttcgtgaagcag
gggctgcgcgatctttctatcagccgcaccagctttaaatggggcattcccgtgccgggg
gatgaagcccacgtgatgtatgtctggtttgatgctctggccaattacctgagtgcgctg
gactaccctaatcctgacgcgccccgtgctgcgttctggcctgcaaatctgcatctggtg
gggaaggatattgcccgtttccatgccatttactggccagccttcctgatggctgccggt
attgaggtaccaaagaagatttttgcgaacggctggtggaccattgaaggccagaagatg
agcaaatctctgggcaatgtggtcgatccgcgtgatctggcaaaagaatttggtttggat
gccgtcaggttctttctgctgagggaagtaccgtttggcggagacagtgatctttcccgt
aagtctctgatcacgcgcaacaacgtggaacttgcgaacgatcttggcaatctctgccag
cgcacgctctctctggttgcccgaaactgcgatggtatcattccagagcgtcgggcgctg
acggaagctgatacccatctcctggggcaggtgagtgttctgccggagttgatggccgcc
caactggaacgctgtgcattgacggatgcgctggaagacgtctggaaagtaatccgggca
ggcaatgcctacattgatcatcaggctccgtgggcgctgcgtaagaccgatatcgaacgg
atgcaagacgttctgcgggttctactggatgcattgcgcggtattgccacagtgcttcag
ccgttcatgccgcagagcatggatcgcatgttgacccagcttggggttgaagatggtgag
cggacattcgcttcactggaaatcctgcttccggctgggcgcaagctgccagcaccacag
ggtatcttcccgcgttatgtagaacccacggcagagccttcatga

DBGET integrated database retrieval system