KEGG   Amborella trichopoda: 110007204Help
Entry
110007204         CDS       T02990                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
atr  Amborella trichopoda
Pathway
atr00260  Glycine, serine and threonine metabolism
atr01100  Metabolic pathways
atr01110  Biosynthesis of secondary metabolites
atr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:atr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    110007204
Enzymes [BR:atr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     110007204
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 110007204
NCBI-ProteinID: XP_020522561
Position
Unknown
AA seq 108 aa AA seqDB search
MARILDKETVIFVPFGTMSNLISVMVHCEIRGSEVILGDQSHIHLLENGGISTIGCAHSR
TVPSNLDRTMDINFIEPAIKDSAEAMCYPTTRLIFLKNMHAKYVSLLV
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaattctggataaagaaacagtcatttttgtgccttttggtacaatgagcaat
ctcattagtgttatggttcactgtgagattagaggaagtgaagtgattcttggagatcaa
agccatattcatcttttagagaatggagggatttcgacaattggatgtgctcattcaaga
acagttccgagcaatttggatagaaccatggatatcaattttattgaacctgcaatcaag
gattctgcagaggccatgtgttatccgactacacgtcttattttcttgaagaatatgcat
gctaagtatgtttctcttctggtttga

DBGET integrated database retrieval system