KEGG   Amborella trichopoda: 110007883Help
Entry
110007883         CDS       T02990                                 

Definition
(RefSeq) putative amidase C869.01
  KO
K01426  amidase [EC:3.5.1.4]
Organism
atr  Amborella trichopoda
Pathway
atr00330  Arginine and proline metabolism
atr00360  Phenylalanine metabolism
atr00380  Tryptophan metabolism
atr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    110007883
   00360 Phenylalanine metabolism
    110007883
   00380 Tryptophan metabolism
    110007883
Enzymes [BR:atr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     110007883
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase RDM
Motif
Other DBs
NCBI-GeneID: 110007883
NCBI-ProteinID: XP_020527439
Position
Unknown
AA seq 512 aa AA seqDB search
MGPSPRLVALLIFSPLHLLSLSFGFEIKEATVSQIQQAFKRKELTSRDLVEFYLREIKGL
NPLLRAVLEVNPGALDQADEADKEREATYGDCAEGLHGIPVLLKGNIATRDWLNTTAGSL
ALLGSVVPRDAGVVRRLRAAGAIILGKASMSKWAEFRSLKTPMGCNAIGGQPKNPYVLSA
NPSGSSTGSAISAATNLATVTLGTETDGSIITPSSANSLVGIKPTLGLTSRAGVILISPR
QDTVGPICRTVLDAVFVLDEIVGFDQRDKKATIAASKFIPAGGYKQFLKAEGLRGKRLGI
LREPFFNFSGTSVLAQTFETHFKTLRQKGAILVDNVEISNINVILDVRESGEGLALLYEF
KKALNAYLSELLVSPVRTLSDVIAFNIKHSKEEKLKEYGQDIFILAESLNRSNSSQVKRA
ISNLKELSRNGIEKVMREKKLDAILAPANTPVYTILAIGGYPGITVPAGYDEEGVPFGIC
FGGLRGSEPKLIEIAYSFEQATHIRRPPTFKS
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgggtccatccccacgcctggttgcattgctcatcttctctcctcttcatcttctatct
ctctcttttggctttgagattaaggaagccacagttagccagattcaacaagccttcaag
cgcaaggagctcacatcgagagacctcgtcgagttctatctccgagaaattaaagggctc
aatccgcttctacgtgcagtgctcgaagtgaacccgggcgcgttggaccaagccgacgag
gccgacaaagagagagaagccacatatggagattgcgccgaagggttacatggtataccg
gtgctgctaaagggtaacatagcgacgcgagactggctcaacaccacggctggatcactc
gcgttgcttggctcggtggtgccacgagatgcaggggtagttcggaggctgagggcggca
ggggctatcattttggggaaggcgagcatgagcaagtgggcggagtttaggtcccttaag
acgcctatggggtgcaatgcaattggtggtcagcctaagaacccctatgtcctgtcggct
aacccatctggatcgagcactgggtcagcaataagtgctgcaacaaatctagcaactgta
actttaggcaccgaaactgatggctccatcattactccatcaagtgctaacagcctagtt
gggatcaagcccactcttggcctcactagtagagctggagttattcttatatctcctcga
caagacactgttgggccaatttgccggactgtattggatgcagtgtttgttttggatgaa
attgttggttttgatcaaagggacaagaaagctacaatagcagcatccaagttcatacct
gctgggggttacaagcaatttctcaaggcagagggtcttagagggaaaagattggggatc
ctaagagagcctttcttcaatttctcagggacatctgtgttagcacagacattcgaaacc
cattttaaaacattaaggcaaaagggagccattctggtagataacgtagaaatatcaaat
attaatgtcattttggatgttcgagagagcggagaagggttggcattgctctatgagttc
aaaaaggcattgaatgcttacttgtctgagctattggtttctcctgttaggacattgtca
gatgtgattgctttcaatataaagcattcaaaagaggagaagctgaaagagtatggacaa
gacattttcatactggctgagagcttaaacaggtcaaacagtagccaagtgaaaagggcc
atatcaaatctcaaagagttatcaagaaatggtattgagaaggtgatgagggagaagaaa
ttagatgctattctggctcctgctaatactccagtctataccatattagcaattggaggt
tatcctgggatcactgtgcctgctggctatgacgaggaaggtgtgccatttgggatttgt
tttggtggactcaggggctcagagcccaagttgattgagatcgcctattcttttgagcaa
gcaacacacattagaaggcctccaaccttcaagtcttga

DBGET integrated database retrieval system