KEGG   Amborella trichopoda: 18422047Help
Entry
18422047          CDS       T02990                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase NIMA-interacting 4
  KO
K09579  peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 [EC:5.2.1.8]
Organism
atr  Amborella trichopoda
Brite
KEGG Orthology (KO) [BR:atr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:atr03110]
    18422047
Enzymes [BR:atr01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     18422047
Chaperones and folding catalysts [BR:atr03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    18422047
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rotamase_3 Rotamase Rotamase_2 ST7
Motif
Other DBs
NCBI-GeneID: 18422047
NCBI-ProteinID: XP_006827323
UniProt: W1NHA4
Position
Unknown
AA seq 143 aa AA seqDB search
MGKDSKAKDAGGKGKGKQASSGGGDEAKGAKGKAKSDLGTCTYVKARHILCEKQGKINEA
YKKLQDGWLSNGDKVPPAEFAKLASEYSECPSGKKGGDLGWFPRGKMAGPFQDVAFSTPV
GATSAPFKSTHGYHIILSEGREN
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggactcgaaggcgaaagatgcgggggggaaaggaaagggaaagcaggcatcg
tccggaggaggggatgaggccaagggcgccaaaggcaaggccaagtcagaccttggaacc
tgcacttatgtcaaagcgaggcacatattatgtgagaagcaagggaagatcaatgaagcg
tacaagaagctgcaagatggttggctaagcaatggtgacaaagtacctcctgctgagttt
gccaagcttgcatcagagtactcagaatgcccatcagggaagaaaggtggtgatcttgga
tggtttcctcgtggaaagatggctggcccttttcaagatgtggctttcagcacacctgtt
ggtgccacaagtgcaccatttaaatcaacgcatggatatcacataatactatctgaaggc
agggagaactga

DBGET integrated database retrieval system