KEGG   Amborella trichopoda: 18423117Help
Entry
18423117          CDS       T02990                                 

Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
atr  Amborella trichopoda
Pathway
atr00601  Glycosphingolipid biosynthesis - lacto and neolacto series
atr00603  Glycosphingolipid biosynthesis - globo and isoglobo series
atr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    18423117
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    18423117
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:atr01003]
    18423117
Enzymes [BR:atr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     18423117
Glycosyltransferases [BR:atr01003]
 Glycan extension
  P blood group
   18423117
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth
Motif
Other DBs
NCBI-GeneID: 18423117
NCBI-ProteinID: XP_006827810
Position
Unknown
AA seq 445 aa AA seqDB search
MVVMLRTLRLILQKITTSSSLRSFSLFFFLPTFSLAALLLLVSACNGVTIFCLHLPFPAN
PTSENIHFSPENTVRGPRTVSVMYAIKEEENHLSKELETHRSFKLLTQKEDNENSLVPPL
NTTVDGRIRWFKENRSRFRILKSGPLTKQFSARAKGFFSSNSCKLRFFMTWISSLESFGF
REFFTVESVFKSHPSACVLILSKAMDSRKGNIVLRPLLTKGYRVMAIAPDFEYLFRKTDA
EAWFNQLGRGNVDPGEVSLGQNLSNLLRLAVLYKFGGVYIDSDVIVMKSFAGLRNAIGAQ
TVDLETGKWSRLNNAVMAFDKSHPLLYKFIEEFALTFDGNKWGHNGPYLVSRVVERPDFN
FTVLPPMAFYPVNWSKIPSFFRRPSNGKELKWVLAKLGHIRRVSYAVHLWNRHSKRLRVE
DGSIISHLMSDCCILCNVSGSSYLT
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggtggtcatgctcagaacccttcgtttgattcttcaaaagatcactacttcttcttca
ctgagaagtttctcgctctttttcttcttacccaccttctctctagctgctctcttgctc
ttagtgtcggcctgcaatggggtcaccatcttctgcctccatctcccttttccggcaaat
cccacatcggaaaacatccatttctcaccggaaaacacagtcaggggtccaagaacagtt
tcagtcatgtatgctatcaaggaagaagaaaatcatctctctaaagagcttgaaacccat
cggagtttcaagcttttgacacaaaaagaggacaatgagaactctttagttcccccatta
aacaccactgtagatggcaggatcaggtggttcaaagagaacaggtccaggttcaggatt
ctcaagtccgggcctctcactaagcagttttctgcaagagcaaagggtttcttcagttct
aattcatgtaagctccgtttcttcatgacttggatttcttctctcgaatcctttggtttt
agagagtttttcacagtggagagtgtgttcaagtctcacccaagtgcctgcgttctcata
ctctcgaaagccatggattcgaggaaagggaacattgttttgagaccactgttgaccaaa
ggttacagggtaatggcaattgcccctgatttcgaatacctctttcgaaaaaccgatgca
gaggcctggttcaatcagctcgggaggggaaatgtggacccaggtgaagtctctttgggc
caaaacctctctaatctgttgagacttgctgttttgtataaatttgggggggtatacatt
gactctgatgttatagtgatgaagagctttgctggtttgagaaatgcaattggggcacaa
accgttgacttggagactgggaaatggagcaggttgaacaatgcagtgatggcgttcgac
aagagccaccctctactgtacaagttcatcgaggaatttgcgctcaccttcgatgggaat
aagtggggacacaatgggccttatctggtctcgagggtggttgagaggcctgatttcaac
ttcactgttctgcctcccatggccttttatccagtgaattggagtaagattccaagcttc
tttaggaggccgagtaatgggaaggaattgaaatgggtgcttgcaaaattaggtcacatt
cgaagggtgagttatgctgttcatttgtggaacaggcatagcaagagactccgggttgaa
gatgggagcataatcagtcatttaatgtctgattgctgtattctatgtaatgtttcagga
tcttcttatctaacgtga

DBGET integrated database retrieval system