KEGG   Amborella trichopoda: 18427290Help
Entry
18427290          CDS       T02990                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 5-like
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
atr  Amborella trichopoda
Pathway
atr00520  Amino sugar and nucleotide sugar metabolism
atr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    18427290
Enzymes [BR:atr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     18427290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd Polysacc_synt_2 NAD_binding_4 3Beta_HSD
Motif
Other DBs
NCBI-GeneID: 18427290
NCBI-ProteinID: XP_020518607
Position
Unknown
AA seq 287 aa AA seqDB search
MASNGGDVASSQSTSKPSPSPPPLRSSKFSQVRFIVTSSDYLLSLDVLLLRALPEVDLLF
LKTVLKKGKVEGYCGLFIGSKDNLRKWIGHPKFELIHHDVTEPLLIEVDQIYHLSCSASL
IFYKYSPVKTIKTNVIGTLNMLGLAKRVGTRILLTSTSEVIEHPQKGEYWGNVSPIEIRI
ARIFNTYGPRTNIDDGRVVNNFIVQALRDEPLTVQSPGTQTRSFCYVSDMVDGLIRLMAG
DHTRPINLGNPGEFTRMELAETVKEVSKLIDSSIPVKIMDNRPDDPR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaatggtggagatgtggcttcatcccagtcaacatcaaagccatctccttct
ccacctcctctacgcagttctaaatttagtcaagttcggtttatagttacttcttctgat
tatttgctttctctagatgttcttttattacgtgctctcccagaagttgacttgctgttt
ttgaaaactgtacttaaaaagggaaaagtagaaggttattgtggtttgttcattggttcg
aaggacaaccttaggaaatggattgggcatccaaaatttgaacttattcatcatgatgtg
actgaacctttattgattgaagtcgatcaaatttatcacctctcatgctcagcttctctc
atcttctacaagtacagccctgtaaagacaataaagacaaatgttatcggcactctaaat
atgctgggacttgctaagcgagttggaacaagaatcttgctaacatcaacctctgaagtc
attgagcatcctcagaagggagagtattggggcaacgtcagcccaattgagattcgtatt
gctagaatcttcaacacttatggacctcgcacgaacattgatgatggtcgtgttgttaac
aattttatagtgcaggcactcagggatgagccattgacagtccagtctcctggaacacag
acccgcagcttctgctatgtttctgacatggttgatggccttattcgactaatggcaggc
gaccacactagacccatcaaccttggaaatcctggcgagtttacaaggatggagcttgct
gaaaccgtgaaagaggtcagtaagcttattgattcttctatccccgttaagatcatggac
aatagaccagatgatcctcgatag

DBGET integrated database retrieval system