KEGG   Amborella trichopoda: 18427334Help
Entry
18427334          CDS       T02990                                 

Definition
(RefSeq) 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
atr  Amborella trichopoda
Pathway
atr00906  Carotenoid biosynthesis
atr01100  Metabolic pathways
atr01110  Biosynthesis of secondary metabolites
Module
atr_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:atr00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    18427334
Enzymes [BR:atr01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     18427334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 18427334
NCBI-ProteinID: XP_006836449
UniProt: W1NUN2
Position
Unknown
AA seq 610 aa AA seqDB search
MGSLSAKVIFSPSNANTNPFRLHQHHLSLPLDVRPTTSNAALRCSLATPPSALHSALIDL
PSSSSRPAPSSSSSNSNDPPPPPPSPLPHKENTAPNWNLFQRVAASALDAAEKAVVQGLE
KRHPLPKTADPAVQIAGNFAPVAEHPVQHELPVRGRIPKCVEGVYVRNGANPLFEPIAGH
HFFDGDGMIHAVRIRHGLASYSCRYTRTSRLVQEEVLGRPIFPKAIGELHGHSGIARLLL
FSARGLCGLVDPSHGMGVANAGLVYFNDRLLAMSEDDLPYQVRITEAGDLQTVGRYSFNG
QLQSAMIAHPKVDPETGELFTLSYDVVKQPYLKYFSFKPDGTKSADVAIPLEQPTMIHDF
AITPRFVVVPDQQVVFQLHQMLRGGSPLVYDSTKTPRFGVLPRYATDASPIRWVEAPPGC
FCFHLWNAWEEVETNEVVVIGSCMTPPDAVFNDTSVPFRTILSEIRLDLGTGKSSGREIA
PGLNLEAGMVSRKKLGRKSRYAYLAVLEPWPKVSGVAKVDLGTGEVKKLVHGEGCYGGEP
FFVPSGNGGGEEEDDGYVLTFVHNEATAQSELLIIEAKEMKVEAAIKLPSRVPYGFHGTF
ISSKDLQAQA
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atggggagcctttcggcgaaggtcatcttttccccgtccaacgccaataccaacccattc
cgcctacaccaacaccacctctctcttcctctcgatgtaaggcccaccactagcaacgct
gctctgcgctgcagcttagccacgccaccttccgccctgcattcggccctcatcgacctt
ccatcttcttcttcccgaccagcacccagcagcagcagcagcaatagcaatgacccaccc
cctcctcctccctctccgctaccccacaaggaaaacacagctccaaattggaacctcttt
cagagagtggctgcctctgccctcgatgctgccgagaaggcagtggtacagggccttgag
aagcgccatcctctccccaagactgcagaccctgctgtccagattgccggcaactttgcc
cctgtagcagagcatccagtgcagcacgagctccccgtcagaggccgcatacccaagtgc
gttgagggtgtctatgttcggaacggtgccaaccccctgttcgagcccattgctggccac
cacttctttgatggggatggaatgatccatgccgtccgcatccgccacggtctcgccagc
tactcgtgccgatacacccgaaccagccgtctcgtgcaggaggaggtactcggccgcccc
atcttccccaaggccatcggagagcttcacggccactccggcatcgcccgcctcctcctc
ttctccgcgcggggcctctgtggcctggtcgaccccagccatggcatgggcgtcgccaac
gcaggcctcgtctacttcaacgatcgcctcctggccatgtccgaggacgacctaccctac
caagtccgcatcaccgaagcgggtgacctccagactgtgggccgctacagcttcaatggc
cagctccagtccgctatgatcgcacaccctaaggtcgacccagagaccggagagctcttc
accttgagctatgacgtggtgaagcagccctacctcaagtacttcagcttcaagcccgac
ggaacgaagtccgctgatgtggccatcccactggagcagcccacaatgatccacgacttt
gccatcacccctcgcttcgtcgttgttcccgaccagcaggttgtcttccagctccaccag
atgctgcgcggcggttcccccctcgtctacgattcgaccaagaccccacgcttcggtgtc
ctcccacggtatgccaccgatgcgagcccaatccgctgggttgaggccccgcctggctgc
ttctgcttccacctgtggaatgcttgggaggaggtcgagaccaatgaggtggtggtgatc
ggctcctgcatgacccctcccgacgccgtcttcaacgacacatctgtacccttccgaacg
atcctctcggagatcaggcttgacctcggtaccgggaaatcgagcgggcgtgagatagca
ccagggctcaacctggaggcagggatggtgagtaggaaaaagctaggccgaaagtccagg
tacgcgtacctcgcggtgctcgagccttggccaaaagtttcaggggtggccaaggtggac
ctcggcacaggagaggtcaagaagttggtccatggcgaggggtgctacggaggcgagcca
ttctttgtccccagtggcaatggaggtggggaagaggaggacgatggctatgtgctgacg
ttcgttcacaacgaagcaacagcgcagtcggagctgctgataatagaggcaaaggagatg
aaggtggaggctgccatcaagcttccttccagggtgccctatggattccatggcaccttc
atctcctccaaagatttgcaggcgcaggcctag

DBGET integrated database retrieval system