KEGG   Amborella trichopoda: 18427820Help
Entry
18427820          CDS       T02990                                 

Definition
(RefSeq) methionine S-methyltransferase
  KO
K08247  methionine S-methyltransferase [EC:2.1.1.12]
Organism
atr  Amborella trichopoda
Pathway
atr00450  Selenocompound metabolism
atr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    18427820
Enzymes [BR:atr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.12  methionine S-methyltransferase
     18427820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Methyltransf_31 MTS PrmA Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12 Met_10 Methyltransf_32 Methyltransf_4 FeoB_Cyto YscO-like
Motif
Other DBs
NCBI-GeneID: 18427820
NCBI-ProteinID: XP_011621019
Position
Unknown
AA seq 1081 aa AA seqDB search
MVKDYTVAMEEFLKLCEESGDSAYNAFKAILEKLENPSTRSETRVFLASLQRRFESKESS
LKCFSDYHFRIHDVLLANEEGQNRKKLTMMEIPSIFIPEDWSFTFYEGINRHPDSIFRDK
TVAELGCGNGWISIALAEKWCPSKVYGLDINPRAIKVAWINLYLNALDENGLPIYDQDKK
TLLDRVEFHESDLLAYCRDHSIILDRIVGCIPQILNPNPEAMSKMITENASEEFLYSLSN
YCALQGFFEDQFGLGLIARAVEEGIEVIQPMGFMIFNIGGRPGQAVCKRLFERRGFRITK
LWQTKVIQAADTDISALVEIEKNSHHRFEFFMGLAGDQPICARTAWAYGKAGGRISHSLS
VYSCELRQPNQVKKIFDFLKNGFQEVSGALDLSFDDDSVADEKIPFLAYLASILKENSSF
PYEPPAGSTRFRNLIASFMRIYHHIPLDINNVVVFPSRAVAIENALRLFSPRLAIVDEHL
TGHLPKQWLTSLAIEGNESTEDMLTVLQAPRQSDLLIELIKKLKPQVVVTGMAKFEVITS
SSFEQLLEATREIGCRLFLDISDHLELSSLPAINGVLKYLAGNILPPHAAILCGLVKNQV
YSDLEVAFVISEEENLFSALSKTVELLQGHTAVSSQYYYGCLFHELLAFQLADRHPPAQR
EPAKETSMKMIGFASSAMSTLNDPELSTPLPPIDKNNSGPNDPVIIHMDMDQNCLPTPSA
VRAAIFESFARQNMTDAETDVGPGIRDLISSKYGLPLTGPSEIIYADSPLALFTKLVLCC
IQEGGTLCIPFGSNGNYILTAKFLKANVSTIPTLPDNGFKLTENILKGFLPGVKRPWVYL
SGPTVNPTGSIYTKEEIEGVLSICSTDGARLVMDTSFSGLEWKRETWGGWDLGKVGSELC
LSVLGGLSFDVLTRGLDFGFLVLNNADVIELFHGFPGLSQPHGTVRYAVKKLLDMREHKA
EVLAEAVAEHKKTLESRAAKLRETLERCGWDVVDCHGGVSMVAKPSAYIGKPLMLNKFHE
ETCLTESNIREAILKTTGLSINSASWTGIPAHCRFTMALEENEFKQALERIQNFKEIVLG
S
NT seq 3246 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggattacacagtggccatggaagaattcttgaaactctgcgaggaatctggt
gattcagcttacaatgcattcaaagcaatccttgagaagctcgagaacccgagcactcga
tctgaaactcgagtgttcttggcttcgcttcaaaggaggtttgaatccaaggaatcttct
ctcaagtgtttctctgactaccatttcaggatccatgatgttctccttgccaatgaagaa
ggtcagaataggaagaagctgacaatgatggaaattcccagtatatttattccagaagat
tggtcatttaccttttatgaaggtataaataggcatcctgattctatcttcagagacaag
acagttgctgagcttggttgtggaaatggatggatttctattgctctcgcagaaaaatgg
tgcccttcaaaggtttatggcctcgacatcaatcccagagcaataaaagttgcttggata
aatttatatcttaatgctttggatgagaatggactgcctatctacgatcaggataagaaa
acattgctcgatagagtggagttccatgagtcagatcttttagcgtactgtagagaccat
agcataatactcgatcgcattgttggatgcataccacagatacttaacccaaaccctgag
gcaatgtcaaagatgattacagagaatgccagtgaggaatttttatattcattaagtaac
tattgtgcacttcagggattttttgaggaccaatttggcctaggtcttattgctagggct
gtggaggagggaatagaagtcattcagcccatgggcttcatgatattcaacattggaggt
cgaccaggacaagccgtttgcaagcgcttgttcgaacgccgaggatttcgtattacaaag
ctttggcagacaaaagtaatacaggctgccgacactgatatttcagctttggttgagatt
gagaaaaatagccaccatcgctttgaattcttcatgggtcttgctggtgaccagcccatc
tgtgctcgaacagcatgggcatatggaaaggctgggggtcgcatctcccattctctgtca
gtatacagttgtgaacttcgtcaaccaaatcaggtgaagaaaatatttgattttctcaag
aatgggtttcaagaggtcagtggtgccctggatttatcttttgatgatgactctgtggca
gatgaaaaaattccttttcttgcttatctcgcgagcattctcaaggagaactcctctttc
ccctacgagcctccagctggaagcacgagattccgtaatctaattgcaagctttatgaga
atttatcatcatatcccactcgatataaataatgtggttgtgttcccatcaagggctgtt
gcaatagagaatgctcttcggttgttctcaccacgacttgcaatagtggatgaacatctc
accggacacttgccaaagcagtggctgacgtctttggctattgaggggaatgagtccaca
gaggatatgcttacagtgttacaagctccacgccagtctgatctattgatcgagctgatc
aagaagctgaaacctcaggttgttgttacaggcatggctaaatttgaggtcatcaccagt
tcttcttttgagcagctacttgaagcaactagagagatcggttgtcgtcttttcttggac
atatctgaccatctcgagctctctagtttgcctgctataaatggggtcctgaaatacctt
gctggaaatattttacccccacatgcggcaatattatgtggcctcgttaagaatcaggtt
tactctgacttggaagtagcatttgttatttcagaagaggagaatctcttcagtgcttta
tccaagacagttgagttgctacagggccatacagctgtgtccagccagtactattatggt
tgcctctttcatgagctgctcgcctttcaacttgcggatcgccatccaccagctcagaga
gaacccgcaaaggagacctccatgaagatgatcggatttgccagctccgccatgtcaact
ctgaatgacccagaactgtccacccctcttccacccatcgacaaaaacaatagcggcccc
aatgaccccgttataattcacatggacatggaccagaactgtctcccgaccccatcagct
gtaagggctgccatctttgagagcttcgcaaggcaaaacatgactgatgccgaaaccgac
gttggccctggtatccgcgacctcatctcatccaagtatgggctccccttaacaggcccc
tccgaaataatttatgcagatagcccccttgccctcttcaccaagcttgtgctctgttgc
attcaagagggtggaaccctttgtatcccctttggctctaatggaaactacattctcact
gccaaattcctcaaagcaaatgtctcaaccatacccacattgcctgataatggattcaag
ctcactgaaaacattctcaaaggtttcttgcctggtgtgaagaggccttgggtttatctt
tctggccccacagtgaacccaacaggatctatttacactaaggaagagatagagggtgtt
ctctccatatgctctacagatggagcgaggctggtaatggatacttctttctcaggtttg
gaatggaagagagagacttggggtggttgggatttggggaaggtcgggtcagagctttgt
ttgtcggtgctcggaggattatcttttgatgttttaacaaggggcctggactttggcttt
ttggtgttgaacaatgctgatgtgattgagctctttcatggctttcccgggcttagccaa
cctcatggcactgtgaggtatgcagtgaagaagctgttggatatgagagagcacaaggct
gaggtcctggcagaggctgttgcagagcacaagaagactctcgagagcagagcagcaaag
ttgagagagacactagaaaggtgtggatgggatgtggtggattgtcatgggggtgtgtca
atggtggcaaagccttcagcctatattgggaagcctctaatgctgaacaagtttcatgaa
gagacctgtctcactgaatcaaacatcagagaggccatcctcaaaactactggcctctct
atcaacagtgcttcatggacagggatcccggctcattgccgattcaccatggcccttgaa
gaaaatgaattcaagcaggccctagaacgcatacagaacttcaaagaaattgtactcgga
agctaa

DBGET integrated database retrieval system