KEGG   Amborella trichopoda: 18428036Help
Entry
18428036          CDS       T02990                                 

Definition
(RefSeq) erlin-2-B isoform X1
  KO
K23341  erlin
Organism
atr  Amborella trichopoda
Brite
KEGG Orthology (KO) [BR:atr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:atr04121]
    18428036
Ubiquitin system [BR:atr04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    18428036
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 HisK_sensor Tap-RNA_bind
Motif
Other DBs
NCBI-GeneID: 18428036
NCBI-ProteinID: XP_011621111
Position
Unknown
AA seq 346 aa AA seqDB search
MDAQRARPNPPQDPPLPPMIFIGFIGCCLLVLFSGLYANPNGYILHQVPEGHVGAYWRGG
ALLKTITSPGFHLKVPFITQFEPIQVTIQTDQVKDIPCGTKGGVMISFEKIEVVNRLKKE
YVYETLLNYGVKYDKTWIYDKIHHEINQFCSAHTLQQVYIDMFDQIDEKMKEDLQADCTR
YAPGVEIINVRVTKPTIPVSIKRNYEQMEEERTKVLIAMEKQRVAEKEAETQKKIALSEA
EKNSQVSQVLMEQRLMEKESTRRQQEIENDMYLAREKSLADADFYRVMKEAEANRLKLTP
QYLELRFIEAIANNSKIFFGDKVPGMIFDQRLIGNFLKEAKQNDDI
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggatgctcagcgagcgaggcctaatcctcctcaggaccctcctttgccccctatgata
ttcattggtttcatcggttgttgcttactggtactcttttcgggtttatatgcaaacccc
aatggctacattttacatcaagttcctgaaggccatgttggtgcatattggagaggaggt
gcacttttgaaaacaataactagtccaggatttcatttgaaggtacctttcataacccag
tttgagcccatccaggtcaccattcaaacagatcaggtgaaggatatcccatgtggtact
aaaggcggagttatgatcagctttgagaagattgaggttgttaatcgtctaaagaaggaa
tatgtctatgagacattgcttaactacggtgtaaaatatgacaagacatggatctatgat
aaaatacaccatgagatcaatcagttttgcagtgctcacacactgcagcaagtctacatt
gatatgttcgaccagattgatgaaaagatgaaggaagatcttcaagcagattgcactcgt
tatgctcccggtgttgagatcataaatgtgcgtgtgacgaaaccaacaatcccagtcagc
ataaaaaggaattatgaacagatggaagaagagcgcacaaaagtattgattgcaatggag
aaacaacgggtggctgaaaaggaggctgaaacccaaaagaagatcgctttgtcagaggca
gaaaagaattctcaggttagccaagtcctcatggagcaaaggttaatggaaaaggaaagc
acaaggaggcagcaagaaattgagaatgatatgtaccttgctcgcgagaaaagtttggcg
gatgcagatttctacagggtgatgaaagaagctgaagcgaacaggttgaagctcacccca
cagtatcttgagcttcgattcatcgaagctattgcaaataattcaaagatattttttgga
gacaaggtacctgggatgatttttgaccagagattgatcgggaattttctaaaagaagcg
aagcaaaatgatgacatataa

DBGET integrated database retrieval system