KEGG   Amborella trichopoda: 18428200Help
Entry
18428200          CDS       T02990                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
atr  Amborella trichopoda
Pathway
atr03013  RNA transport
Brite
KEGG Orthology (KO) [BR:atr00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    18428200
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:atr03012]
    18428200
Translation factors [BR:atr03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    18428200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 18428200
NCBI-ProteinID: XP_006837302
UniProt: W1NY10
Position
Unknown
AA seq 956 aa AA seqDB search
MATFAKPENALKRAEELMNVGQKQAALQALHDLITSKRYRAWQKTLERIMFKYVELCVDM
RRGRFAKDGLIQYRIVCQQVNVSSLEEVIKHFLHLSTERAEQAQSQAQALEDALDVDDLE
AEKRPEDLMVSYVSGEKGKDRSDRELVTPWFKFLWETYRTVLEILRNNSKLETLYAMTAH
RAFQFCKQYKRTTEFRRLCEIIRNHLANLNKYRDQRDRPDLSAPESLQLYLDTRFDQLKI
ATELELWQEAFRSVEDIHGLMCMVKKTPKPSLMAVYYAKLTEIFWVSESHLYHAYAWYKL
YALQKSYNKNLAQKDLQLMASSVLLAALSVTPYDHKHGAAHFELENEKDRSLRIASLLGF
NLDPKRDSREVLSRSALLAELASKGVMTYVPQEVKDLYHLLENEFHPLDLAAKVQPLLGK
LAKLGDKLSSASPIPEVQLAQYVPALEKLTTLRVLQQASQVFQTMKIEVLSKMIPFFDFS
VVEKVSVDAVKYNFIAMKVDHLKGIVLFGSMDLESDRLRNHLTVLAKRLNKARSLINPPV
QNVSKLNGMLPALQEAVDKEHKKLLARKVIIEKRKEEQERQMLEMEREEESKRLKLQKIS
EEAEQKRLASEYSRREEQRIRREIEEKELEEAQVLLQEAERRKGKKGKKPVIEGEKVTKQ
SLLELALSEQLKERQEMERKLQKMAKTMDHMERAKREEEVPLVLAAYQQRLVDDKILFED
EQKQATEQSRQQHDGDLQHKAKLLRMLDDKTSFGNMVVSRRKDEFERLQQEREEHTARLR
AMRKQEIERKRKIAYYLQEEEKRLIKLKEEEEARKHEEEERRKKEEAARKAKLDEIAAKQ
RQRELEIEERDRQQREALTRSTSRPSSSTVPPFAASAPEDPPPARGPTEPPAKPAEPSAG
RYVLPRFRREPVATTPSTAAPEPDRWGSRNDDRRPPGSSFSSSRPTDRYRPPRSNY
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atggcaacctttgcaaagccagagaacgctctcaagcgagctgaagagttaatgaatgtg
ggacagaagcaagctgcattgcaagcgcttcatgatctgatcacttcaaagaggtacaga
gcatggcaaaagacccttgagaggattatgttcaagtatgtagaactctgtgttgatatg
agaagggggagatttgccaaggatggtttgattcagtatcgtatagtgtgtcagcaagtg
aatgttagctctttggaagaggtgataaagcacttcttgcatctctcaactgaaagagct
gaacaagcgcaaagccaggctcaagccctggaagatgctctggatgttgacgacttggag
gcagagaaaaggccagaagatttgatggtaagctatgtcagtggtgagaaagggaaagat
aggtcagaccgggagcttgtaacaccatggttcaaattcttatgggaaacctacaggaca
gtgcttgaaattctccggaataactcaaaattggagacactatacgctatgacagcacac
cgggcctttcagttctgcaagcagtacaaacggacaacagaattccgcaggctgtgtgag
attatacgtaatcatttggctaatcttaacaagtacagagatcaaagggacaggccagat
ttatctgcccctgaaagcttacagctatatcttgacaccagatttgatcaactcaagatt
gcaaccgagcttgaactttggcaggaagcatttcgttcagttgaagatattcatggattg
atgtgcatggttaagaaaaccccgaagccttctttgatggctgtttactatgctaagctg
acagaaattttttgggtgtcagaaagtcatctataccatgcatatgcatggtacaagctt
tatgcactccaaaagagctataataaaaacttagctcaaaaggatttgcaattaatggca
tcctcagttttgcttgccgcgctgtcagtgaccccttacgatcacaagcatggtgcagca
cattttgaactagaaaatgagaaagatcgcagtttaaggatagctagccttctagggttt
aatcttgaccctaaacgagatagtagagaagtgctttcccgctcagctcttcttgcggaa
ttggcatccaaaggtgtgatgacttatgttcctcaggaagtaaaagatctgtatcatcta
ctggagaatgagtttcacccattagatcttgcagcaaaagttcagcctttgttgggcaag
cttgccaagcttggtgacaagctgtcttcagcttcacccattccagaggtgcagctagcg
caatatgttcctgcattggaaaagctcactacgctgagagtgctgcagcaggcatcacag
gtgttccagacaatgaagattgaggtcctgtcaaagatgataccattttttgatttttct
gtggtggaaaaggtttctgttgatgctgtcaaatataactttatagcaatgaaagtcgac
catttgaagggtatagttctctttggtagcatggatcttgaatctgataggctgcgaaat
cacttaaccgtccttgcaaagcgtctcaacaaagcaagaagccttatcaatccaccagtc
cagaatgtgtccaaactgaatgggatgctgcctgcattgcaagaagctgtagacaaggag
cacaagaagcttcttgcccgtaaagttataatcgagaaacgtaaggaagaacaagagcgg
caaatgttggaaatggaacgtgaggaggaatcaaagagattaaaattgcagaagatatca
gaggaggcagaacaaaagagacttgcttctgaatattccaggagggaggagcaaaggatt
cgaagagaaatagaggagaaagaactggaagaagctcaggttttgcttcaagaagcagag
agacgtaaaggaaagaaaggaaagaagccagttattgaaggggagaaagttacaaagcaa
tcccttcttgagttggctttaagcgaacagctcaaagagcggcaggaaatggaaaggaag
ctgcagaaaatggctaaaactatggaccatatggaaagggcaaagagggaagaagaggtc
ccactagttttggctgcatatcaacaacgtttggtggatgacaagattctctttgaggac
gagcaaaagcaagcgactgagcagagtaggcagcaacatgatggagacctccagcacaaa
gccaaactcttgcgcatgctggatgacaagacttcttttggtaatatggttgtgagccgg
cgcaaggatgaatttgagagattgcagcaggagagagaggagcatactgcaaggctgcga
gcaatgcgaaagcaggagatagagaggaagaggaagattgcgtattatctgcaagaggag
gagaaaaggcttatcaagttgaaagaagaggaggaagctcgtaaacatgaagaggaagag
aggagaaagaaagaagaagcagcgcgtaaggccaagcttgatgagatcgctgccaagcag
cggcagcgtgagcttgagattgaggagagggaccggcaacagagagaagcccttacccga
agcaccagcagaccctcatcctccactgtgccaccatttgctgctagtgcccctgaggac
cccccacccgctcgtgggcctactgagccccccgcaaagcccgctgagcccagtgcaggc
aggtatgtcctccctcggttccgccgtgagccagtggcaaccaccccttcaacggcagcc
cctgagcccgacaggtgggggtccagaaacgatgataggaggccgcctggttcctcattt
agcagttctcggcccactgataggtaccgccctcctcgatccaattattga

DBGET integrated database retrieval system