KEGG   Amborella trichopoda: 18432425Help
Entry
18432425          CDS       T02990                                 

Definition
(RefSeq) autophagy-related protein 18c
  KO
K22991  WD repeat-containing protein 45
Organism
atr  Amborella trichopoda
Brite
KEGG Orthology (KO) [BR:atr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:atr04131]
    18432425
Membrane trafficking [BR:atr04131]
 Autophagy
  Other autophagy associated proteins
   Others
    18432425
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 18432425
NCBI-ProteinID: XP_006842594
UniProt: W1P9C0
Position
Unknown
AA seq 421 aa AA seqDB search
MATVSPPMSTTVSASRGIHPPNRLGSYEHSSGLSVTPNQSEPESSNNEDVELLSVSWNQD
YGCFSAGTNRGFRIYNCDPFKETFRRDLKNGGFGIVEMLFRCNILALVGGGENPQYPPNK
VMIWDDHQSRCICELSFRSEVRAVKLRRDRIVVVLEHKIYVYNFADLKLLHQIETLANPR
GLCNLSYQSNTFVLACPGLHRGEVRVEHFGLKRTKTINAHDAHIACFTLTLDGLLLATAS
TKGTLIRIFNTMDGTRLQEVRRGVDRAEIYSIALSAKVQWLAVSSDKGTVHIFSLRVRVA
GEDSSSDSSNNGQGPALTHQSSSTSVDALISPNTGANQSSSLAFMKGVLPKYFSSEWSFA
QFHLPVDTRFLVAFGAQSTVLIVGMDGSFYRCSFDALLGGQMTQQEYFRFLNTDSKAKPG
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggccactgtttcaccacccatgagcacgactgtctctgcatctaggggaatccaccct
cccaaccgactcggctcatacgaacattcatcaggtttaagtgtcactcccaatcaatct
gaaccagagtctagcaacaatgaggatgtggaattgttatcggtgtcttggaatcaggac
tatggatgcttttcagctgggacaaaccgaggtttcaggatatataattgtgaccctttc
aaggagacttttaggagggatttgaaaaatggaggttttggcattgtagagatgcttttc
cgatgcaacatcttggcccttgtaggaggtggggaaaacccacagtacccacctaacaaa
gttatgatatgggatgatcatcaaagccggtgtatttgtgagctctcatttagatcagag
gttcgagctgtgaaattgagaagagaccgcattgttgtggttctagagcacaagatctat
gtgtataactttgcggatttgaagcttcttcaccagatagagactcttgcgaatccaagg
gggctgtgcaatttatcttatcagtcaaatacctttgtattggcttgtcctggtttgcat
cgaggggaggttcgggtggaacactttggcttgaagagaacaaagactattaatgctcat
gatgctcatattgcatgcttcactttaacattggacgggcttttgcttgcaactgctagc
acaaagggcacattgatcagaattttcaacaccatggatggaactcgcctacaagaggtg
cgccggggcgtggatagggctgaaatttatagcatcgctctctctgcaaaagtgcaatgg
ttggcagtgtctagtgataaagggaccgtccatatattcagtctcagagttagggtggct
ggagaggattcttcctcagattcttcaaataatggtcagggtccagctttaactcaccag
agctcttcgacttcagttgatgctcttatttctccaaacactggggcgaaccagagttct
tctttggccttcatgaaaggggttctaccgaaatacttcagctctgagtggtcatttgct
cagttccatttaccagttgacacccgctttctggtggcttttggggcccaaagcacagtc
ttaattgtcggcatggacgggagcttttacaggtgctcatttgatgcactgttgggaggg
cagatgacgcaacaagagtatttccggttcctgaatactgatagtaaggcaaagcctggg
gcataa

DBGET integrated database retrieval system