KEGG   Amborella trichopoda: 18434132Help
Entry
18434132          CDS       T02990                                 

Definition
(RefSeq) monofunctional riboflavin biosynthesis protein RIBA 3, chloroplastic
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
atr  Amborella trichopoda
Pathway
atr00740  Riboflavin metabolism
atr00790  Folate biosynthesis
atr01100  Metabolic pathways
atr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:atr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    18434132
   00790 Folate biosynthesis
    18434132
Enzymes [BR:atr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     18434132
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     18434132
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_cyclohydro2 DHBP_synthase
Motif
Other DBs
NCBI-GeneID: 18434132
NCBI-ProteinID: XP_020522824
Position
Unknown
AA seq 538 aa AA seqDB search
MDCSPLFLHSSYPTTTHIRSCHCPYAGVHSVGLQLNLKGQSLFACRVQGTSENVDSSIAG
VSSSSSNYLGDENGSLFGGLDEEKVTSFTTLTAEITPETTDFFVSDAEDDPDCPSEGFSS
IDQAIDALSQGKFIIAVDDEGDDIEGDLIMAASFVTPQAVAFMIRHGCGIVSVAMKEEDL
ERLKLPMMFPDNDNEETFHKSFTISVDAKGGKSAGVSAFDRAKTILSLASSDSKPDDFRK
PGHVFPLKYRNGGVLKRAGHTEASVDLVTLAGLKPLSAICGILDPNDGSMAQLSQLKKIA
EEYSLPIISITDLIRYRRKREKLVERIVVSRLPTKWGLFQAYCYRSKLDGFEHIALVKGN
IGNGQDVLVRVHSECLTGDIFGSARCDCGNQLSLAMQLIEQAGRGVVVYLRGHEGRGIGL
GHKLRAYNLQDEGHDTVEANLQLGFSADSREYGIGAQILRDIGVRTMQLMTNNPAKFTGL
KGYGLAVVGRVPVISLITAENQRYLETKRVKMGHVYGSDLPSTVAVDVDTDNPAKDTL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggattgctccccacttttcctccactcttcttatccaacaaccacccacattagaagc
tgccattgtccttatgctggtgtacacagtgttgggcttcaattgaatctgaagggtcaa
tctttatttgcttgtcgagtccagggcacaagtgaaaatgtggattcgagcattgctggt
gtttcttcttcttcttccaattatttgggagatgaaaatggttctctctttggtggtttg
gatgaggagaaggtcacttcttttactactttaactgcagaaatcacccctgaaacaaca
gatttctttgttagtgacgcggaggatgaccctgactgcccatcagagggtttttcttcg
atagaccaagctattgatgcacttagtcaaggaaagtttattattgctgtagatgatgaa
ggggatgacattgaaggggatcttataatggcagcatcttttgtaaccccacaggctgtg
gcttttatgattcgtcatgggtgtggtattgtttctgttgcaatgaaggaggaggatttg
gagagactcaagttacccatgatgtttcctgacaatgacaatgaggagacatttcacaag
tcttttacaatttcagtggatgcaaagggtggaaaatctgctggtgtttcagcctttgat
agggcaaagactattctttctcttgcatcttctgattcaaaaccagatgattttagaaaa
cctggacatgtatttcctttgaagtatagaaatggtggtgtccttaaaagagctgggcat
actgaggcttcggttgatttagttaccttggctggcttaaaaccattatctgccatttgt
gggattcttgatcccaatgatggttcaatggcccaattgtcccagttaaagaagattgca
gaggagtatagcttaccaatcatatcaatcacggaccttatcaggtatcggagaaaacgt
gaaaaactagttgaaaggattgttgtttcacgtttacccacaaaatggggtctatttcag
gcatattgttataggtcaaagttagatggattcgagcatattgctcttgtaaagggaaat
attgggaatgggcaagatgtcctagtaagagtacactcagaatgcttaactggtgatatt
tttggatctgctcgttgtgattgcggaaatcaattatcattggcgatgcaactgattgag
caggctggtaggggggttgttgtttatcttcgtggtcatgaaggaagagggatcggttta
ggtcacaaacttcgtgcatacaatcttcaggatgaaggacacgatactgtggaagccaat
ttgcaacttgggttctctgctgattctcgtgaatatggtattggtgcacagatactacgg
gacattggcgtgcgtactatgcaactgatgactaacaatccagccaagttcactggcttg
aaaggatacgggttggcagtggtgggccgcgtgcctgttatctcactcatcacagccgaa
aaccagaggtacttggagactaaacgcgtaaagatgggccatgtgtatggctccgatttg
ccaagcaccgttgccgtggatgtagatactgacaatccagcaaaagatacactataa

DBGET integrated database retrieval system