KEGG   Amborella trichopoda: 18435519Help
Entry
18435519          CDS       T02990                                 

Definition
(RefSeq) autophagy-related protein 16
  KO
K17890  autophagy-related protein 16-1
Organism
atr  Amborella trichopoda
Pathway
atr04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:atr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    18435519
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:atr04131]
    18435519
   03029 Mitochondrial biogenesis [BR:atr03029]
    18435519
Membrane trafficking [BR:atr04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    18435519
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    18435519
Mitochondrial biogenesis [BR:atr03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    18435519
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 Atg14
Motif
Other DBs
NCBI-GeneID: 18435519
NCBI-ProteinID: XP_006845626
UniProt: W1PI49
Position
Unknown
AA seq 510 aa AA seqDB search
MDGPAVMAIRHALSALRRRHLLEEGAHIPAFSALSRQFVTQGSEWKEKAEGLEVELQQCY
KAQARLSEQLVVEVAECRDAKALLQEKETSLNELQKEVAEGRDEISKLKELLEENRKALD
LAISENQELRSQLEEEILKARNAESENKMLIDRWMMQKMQDAERLNEANAIYKEMMDKLK
ASNMQQLVQQQVDGVVRLSETWTSEALTDLPSPTWKHRLQAHEGACGSILFEPNSDCLIT
GGLDQIIRVWDTRTGTNTNTLTGCLGSILDLAIARDKCIIAATSSNKMFVFDQLSRRLSH
TLTGHLDKVCAVDASKVSGKSLVSAAYDRTIRTWDLVKGYCTATLMCHSNCNALCYGIDG
QTVFTGHVDGNLRLWDLRVSGGGKMVSEVAAHAYSVTSVSLSRGGLLVLTSGRDNVHNLF
DVRASLEVCGNFRGGSGSATNWNRSCISPDDNYVVAGSSDGMVHVWSRREKGEIVSMLRG
HEASVLTCAWSDTGGPLASADKKGAVYLWV
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggatggaccggcagtcatggctatcaggcatgccttgagtgcacttcgaaggcgtcat
ttacttgaggaaggggctcatattccagctttttctgccttgtcaagacaatttgtgaca
cagggctcagagtggaaggagaaagcagaaggccttgaagttgaactacaacagtgttac
aaagctcaagcgcggctctcagaacagcttgtagtagaagtggcagagtgcagagatgca
aaagctttgcttcaagagaaagaaaccagtttaaatgaactacagaaggaagttgctgaa
ggaagggatgaaatatccaagttgaaggagttactagaggagaacaggaaagctcttgac
ctggctattagtgaaaaccaagagctcagatcacagttggaagaggaaattttgaaagca
aggaatgccgaatctgaaaacaagatgctgattgatcggtggatgatgcaaaagatgcaa
gatgcagaacgactcaatgaagccaatgccatatataaagagatgatggacaagctcaag
gccagcaacatgcaacagctagtgcagcaacaagtcgacggggtcgtcaggctgagtgag
acttggaccagcgaggcactgactgaccttccctcacctacatggaagcacaggctccaa
gcccatgaaggtgcatgtggctcaatcctctttgagcccaactctgactgcctcataacc
ggagggcttgaccaaattatcagggtatgggatacaagaaccggtaccaatacgaacacc
ctaactggctgccttggttcaattcttgatctagccatagcccgcgataagtgtatcatc
gcagcaacaagttcgaacaaaatgtttgtgttcgaccaactctcaaggcgacttagtcac
accttaacgggccatcttgacaaggtttgtgcagttgatgcgagtaaggtttcgggcaag
agcctggtaagtgcagcctatgatcgaaccattaggacttgggaccttgtcaaggggtat
tgtactgcaactcttatgtgtcatagcaattgcaatgcgctttgctatgggatcgatggg
caaactgtgtttacagggcatgttgacggcaacctgaggttatgggatttaagggttagt
ggtggagggaaaatggtaagtgaggtggcagctcatgcttattcggtgacatcggtttct
ctctctcgcggtggcttgctagttctaaccagtgggagagacaacgtgcataacttgttt
gatgtaagggcctcactggaggtttgtgggaacttcaggggagggagcggaagcgcgacc
aattggaatcggtcttgtattagcccggacgacaattatgtggtggcagggtcgagtgac
ggtatggtgcatgtttggtcgaggagagagaagggtgaaattgtgagcatgttaagaggg
cacgaggcttcggtgctcacatgtgcatggagtgatacgggggggcctttggcatctgct
gataagaagggggccgtgtacttatgggtgtga

DBGET integrated database retrieval system