KEGG   Amborella trichopoda: 18440788Help
Entry
18440788          CDS       T02990                                 

Definition
(RefSeq) aspartate--tRNA ligase 2, cytoplasmic
  KO
K22503  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
atr  Amborella trichopoda
Pathway
atr00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:atr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    18440788
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:atr01007]
    18440788
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:atr03016]
    18440788
Enzymes [BR:atr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     18440788
Amino acid related enzymes [BR:atr01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   18440788
Transfer RNA biogenesis [BR:atr03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    18440788
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon tRNA-synt_2d
Motif
Other DBs
NCBI-GeneID: 18440788
NCBI-ProteinID: XP_006850989
UniProt: W1PYI4
Position
Unknown
AA seq 559 aa AA seqDB search
MASEPSPETLTSYLKLSDTDDNGSSHGDSLEKNPEEPPKNISKKAAKKEAMKAEKLKKQQ
QMAASAAQIDELDPLASNYGDIPLKELQSKDISGRVWTEVKSLSEELKDTEVLIRGQAQT
IRAVSKNMAFIVLRERGFTVQCVFTIAPGFVSKQMVKFVTGLSRESYIDVYGVVSVPGVA
IKGSSQQVEVQGRKIFCINRAIPTLPFNLEDAARSEAEFIKAEQTGEQLVRVGQDTRLNN
RVLDMRTPANQGIFRIQYQVCNLFRMFLSSEDFVEIHTPKLIAGASEGGSAVFKLDYKGQ
PACLAQSPQLHKQMAICGNFGRVFEVGHVFRAEDSFTHRHLCEFTGLDVEMEIKEHYFEV
LDIVDRLFVYIFDELNQKCKKELEAVNKQYPFEPLKYLWKTLLLTFKEGIEMLKEAGIDA
DPLGDLNTETERKLGQLVREKYDTDFYILHRYPLAVRPFYTMPCYDDDLYSNSFDVFIRG
EEIISGAQRVHDAEFLSNRAQALGIDLKTISTYVDSFRYGAPTHGGFGVGLERVVMLFCG
LNNIRKTSLFPRDPQRLAP
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctgagccctctccagaaacccttacttcttacttgaaactctctgatacagac
gacaatggctcctctcatggcgattctttggagaaaaacccggaagaacctccaaagaac
ataagcaagaaagcagcaaagaaagaagccatgaaagctgagaagttgaagaaacagcaa
caaatggcagcctctgctgctcaaattgatgaattagaccctttggcttcgaattacggt
gatattcccttgaaggagcttcaatcaaaggatatcagtggccgagtatggaccgaagtg
aagtccttatcagaagaattgaaggataccgaggttttgatccgaggccaggctcaaacc
attcgagccgtgagcaaaaacatggctttcattgtactgagagagagggggttcactgtg
caatgcgttttcactattgctccagggtttgtcagtaaacagatggttaaatttgtcact
ggtttgagcagggaatcatatattgatgtttatggggtggtctcagttcctggagtggca
attaaaggcagctctcaacaggtggaagttcaaggaagaaaaatattctgtattaatagg
gctattccaactttaccctttaatcttgaggatgcagctcgcagtgaagctgaattcata
aaagcagagcagactggagaacagcttgtccgtgtcggtcaagacactcgtttgaacaac
agagtacttgacatgcgcactcctgccaatcaagggatttttcgcattcaatatcaagtt
tgcaatctatttagaatgttcttgtcatcagaagatttcgttgagatccatactccaaag
ttgatcgcgggtgcaagtgaaggaggttcagctgtttttaaactggactacaaaggtcaa
cctgcttgcctagcacaatccccacaactacacaagcaaatggcaatttgtggtaatttt
ggccgtgttttcgaggttggccatgtttttagggcagaagactctttcactcataggcac
ctatgtgaatttacgggccttgatgtggaaatggaaattaaggagcactattttgaggta
ttggacattgtggacagattatttgtgtatattttcgatgaattgaatcagaagtgcaaa
aaggagctcgaagctgtaaataagcaatatccatttgaacctttgaagtacctgtggaaa
actttgctacttactttcaaagaggggattgaaatgctcaaggaagctggcattgatgca
gatcccttaggtgatctaaatacagaaacagagagaaaattgggtcagcttgttcgggag
aagtatgacactgacttctatattcttcaccgctatcctctcgctgtgcgacccttctac
accatgccatgttatgatgatgatttgtacagtaactcattcgatgtattcattcgtggt
gaagaaataatttcaggagctcagcgtgttcatgatgcagagttcttgagcaatcgagca
caggcattgggaattgatttgaagacgatatctacttatgtcgatagcttccggtatggg
gcgcctacacacggcgggtttggtgttggcttagagcgtgtagtgatgcttttctgtggc
cttaacaacattcgcaaaacgtctcttttccctcgtgaccctcaaaggcttgctccatga

DBGET integrated database retrieval system