KEGG   Amborella trichopoda: 18441424
Entry
18441424          CDS       T02990                                 

Definition
(RefSeq) delta(14)-sterol reductase isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
atr  Amborella trichopoda
Pathway
atr00100  Steroid biosynthesis
atr01100  Metabolic pathways
atr01110  Biosynthesis of secondary metabolites
Module
atr_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:atr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    18441424
Enzymes [BR:atr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     18441424
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 18441424
NCBI-ProteinID: XP_006851719
UniProt: W1PYW3
Position
Unknown
AA seq 367 aa
MEDLIRQFIPSLNAAVILLSYFGFFSVAGALSPGKIIPGALLQDGTRKYYRCNGLVSLIM
LIVLLGIAVSMRLISPTFIVDRGAQLLSTTLAFSLVFSIVLYAAGCMSHEKGSSLKPHTT
GNLIHDWWLGIQLNPEIMGVDLKFFFVRAGMMAWLLINLSVLAKSIKDNSLGISMILYQT
YCMLYVLDYFWYEECMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLRNEVTLPTA
AVILNCVIFLIGYRVFRGANKQKHIFKKDPKAPIWGKPPKVIGGKLLASGYWGIARHCNY
LGDILLAFAFSLPCGTRSVVPYFYPIYLFILLIWRERRDEARCQEKYKEDWVNYCKVVPW
RIFPYVY
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggaagatcttattcgacaatttataccttctttgaatgcggctgtcattcttctatct
tactttggcttcttcagtgtagctggagccctaagtcctggtaagattatacctggagca
cttttacaagatggcaccagaaaatactatcgttgtaatggtctggtatcacttattatg
ctgattgttcttctaggcattgctgttagcatgcgattgatatcgcctacgtttattgtt
gatagaggagctcaacttctttctacaacacttgccttcagcttagttttttcaatagtt
ttgtatgctgctggatgcatgtctcatgagaagggttcctctttgaagccacacacaaca
ggaaatttaattcatgactggtggcttggtatccaattgaatccagaaattatgggagtt
gacctcaaatttttctttgttagagctggaatgatggcttggcttcttatcaatctctct
gttcttgcgaaaagtattaaagataacagtttaggcatctcaatgatcctttaccaaaca
tattgcatgttgtacgttctggactacttctggtatgaggagtgcatgacatcaacatgg
gacattattgcagaaaggttgggcttcatgttggtgtttggagatttagtttggattccc
ttcactttcagcattcagggttggtggcttttgagaaatgaagtaacattgcctacagca
gctgtcattttgaattgcgtcatttttttgattggctatcgagtgtttagaggtgcaaac
aaacagaagcacatttttaagaaggatccaaaggctcccatttggggaaaacctcctaag
gttataggtggaaaattgcttgcttcaggttactggggcatcgctcgccattgtaattac
cttggagatatattgcttgcttttgcttttagtttaccatgtggcactagatctgtcgtt
ccatacttctatccaatctaccttttcattctgctgatatggagagagagaagagatgaa
gcgaggtgccaagagaagtataaagaggactgggtcaattactgtaaggttgttccgtgg
cgtatatttccatatgtttactaa

DBGET integrated database retrieval system