KEGG   Amborella trichopoda: 18442442Help
Entry
18442442          CDS       T02990                                 

Definition
(RefSeq) probable protein S-acyltransferase 23
  KO
K20032  palmitoyltransferase ZDHHC13/17 [EC:2.3.1.225]
Organism
atr  Amborella trichopoda
Brite
KEGG Orthology (KO) [BR:atr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:atr04131]
    18442442
Enzymes [BR:atr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     18442442
Membrane trafficking [BR:atr04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    18442442
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 DHHC Ank_4 Ank_3 Ank Ank_5
Motif
Other DBs
NCBI-GeneID: 18442442
NCBI-ProteinID: XP_006852720
UniProt: U5CYH1
Position
Unknown
AA seq 547 aa AA seqDB search
MASSEIEVVSETQNSSTSMNSNGVNGMDLAIADVYSASAYGHLLKLRHFVEKEGRSVSKP
GGDGYYPLQWASFNGYREIAQYIIEHGADVNAFDNTQQTALHWAAVRGFTEVADILLQHG
ARVEAADANGYRAVHVAAQYGQTAFLHHIVTKYNAEFDKPDNDGRSPLHWAAYKGFADTI
RLLLFMDASQGRQDKEGCTPLHWAAIRGHVEACTVLAHAGTKHELLLKDKAGLTPTQLAS
DKGHRHVAVSLSNVQKMHNNSWENKFCLGKIAGIGYAPILLFVIIFLTILFITSVLASPT
FTKVTASVGLWGWTAVSIAIGALLMFYRCSTKDPGYTRMSSAHSTNGKHEDAPLLDLNFH
NSTIWEGNWSQLCPTCKIIRPVRSKHCSTCNRCVEQFDHHCPWISNCVGKRNRWDFFVFV
CLGTLTSSIAAVITLQRLWSNLPLPSSGGAQAHSIVARHPGAAAFLAMDILVLLGATTMT
IAQASQIARNITTNELANASRYAYLRGPDGRFRNPYNHGCWKNCTDFLIHGYNDDEVTWP
SLQEATR
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcggagattgaagttgtctcagaaactcagaattcaagcacttcgatgaat
agtaacggcgtcaatggaatggatttagccattgcagacgtgtattctgcttcagcatat
ggtcacctcttaaagcttcgacattttgttgagaaagaaggtcgcagtgtttcaaaacct
ggtggtgatggctactatccccttcaatgggcttctttcaatggatatagagagattgca
caatacatcattgagcatggagctgatgttaatgcatttgataatactcaacaaacagca
ctgcactgggctgcagttcgaggttttaccgaagtagctgatatactcttgcaacatggg
gcacgcgttgaggctgctgatgccaatggatatcgtgctgttcacgttgctgctcaatat
ggacaaacagctttcttgcatcacatcgtcacaaaatacaatgcagaatttgacaaacct
gataatgatgggaggagcccactgcattgggctgcatataagggctttgcagataccatc
aggttacttctgtttatggatgcttcccaaggaagacaagataaggaagggtgtacacct
ttgcactgggctgcaataagaggccatgtagaggcatgtacagttctcgcacatgcaggc
acaaagcatgaacttctgttgaaagacaaagctgggttgacccccacacaactggcttct
gataaaggtcatcggcatgttgctgtttccctttcaaatgtacagaagatgcacaacaat
agttgggaaaacaaattctgccttgggaagatagcggggattggttatgctcccatcctt
ctgtttgtaataatcttccttacgatcctattcatcacttcagtccttgcatcacctact
tttacaaaggtaactgcttctgttggattatgggggtggactgctgtttctattgcaatt
ggtgcacttttaatgttctatagatgcagcacgaaggatccaggttacacaagaatgagt
tcagcacattctacaaatggcaagcatgaagatgcacccttgttagacctgaattttcac
aactccacgatctgggaaggaaactggtctcaactttgcccaacctgcaaaataataagg
cccgtccgctccaaacattgctcgacttgcaaccggtgtgttgaacaatttgaccatcat
tgcccgtggatatctaattgtgttgggaagagaaataggtgggatttctttgtgtttgtt
tgtctgggaactttaacatcatctattgcagctgttattacactccagaggctatggagt
aatttaccattgccttcgtctggtggtgcacaagcccatagcattgtggctcgacatcca
ggtgctgcagcatttctggccatggacattcttgtgttgttgggtgctacaactatgacc
atagcacaggcttcacagatcgcacgcaatatcacaacaaatgaattggcaaatgctagt
cgttatgcgtatcttagaggaccagatggtcgcttcagaaacccgtacaatcatggatgt
tggaagaattgcactgacttccttatccatggatataatgatgatgaagttacctggcca
tccttgcaagaggctacaagatag

DBGET integrated database retrieval system