KEGG   Amborella trichopoda: 18444520Help
Entry
18444520          CDS       T02990                                 

Definition
(RefSeq) serine decarboxylase 1
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
atr  Amborella trichopoda
Pathway
atr00340  Histidine metabolism
atr01100  Metabolic pathways
atr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:atr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    18444520
Enzymes [BR:atr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     18444520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 18444520
NCBI-ProteinID: XP_006854520
UniProt: U5D3K0
Position
Unknown
AA seq 488 aa AA seqDB search
MVGSVETVSDVVNGIVKEYMAENVEPLPEELNPKKIKVPLHLKNEDGADNGENSTLVSGK
REIVLGRNVHTSCLEVTEPDADDEVTGDREACMASILARYRKSLIERTRHHLGYPYNLDF
DYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELERNEYWGYITNCGT
EGNLHGILVGREVFPDGILYASKESHYSVFKAARMYRMDCVMVNTLVSGEIDCTDFRAKL
LQNKDKPAIINVNIGTTVKGAVDDLDLVIKILEDTGFNHDRFYIHCDGALFGLMMPFVKR
APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLDHINALSRNVEYLASRDATIMGSRNG
HAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDCLRSEGISAMLNELSSTVVFERPQDE
EFVRRWQLACQGNIAHAVVMPNITIEKLDDFVKELTAKRSTWFKDGKAQAPCIADEIGAE
NCACARHN
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggtaggaagcgtggagaccgtctcagatgtagtgaatggaatcgtgaaggagtatatg
gctgagaacgttgagcctttaccagaggagttaaatcccaagaaaattaaggtgcctttg
catctgaaaaatgaagatggtgcagacaatggtgagaacagtactttagtttcaggtaaa
agggagattgttctcggaaggaatgtgcacacgagttgccttgaagttacagaacctgat
gctgatgatgaggttacaggagacagggaggcttgtatggccagcattttggcgaggtat
cggaagtctctcatcgagaggaccagacaccatctgggttatccttacaatctggacttt
gattatggtgctctcgcacaactgcaacatttctctatcaacaacctgggcgatccattt
attgagagcaactatggagttcattcaagacagtttgaagtcggggttctcgattggttc
gctcgtctctgggaattggagaggaacgaatactggggttacataacaaattgtggaaca
gagggcaatttgcatggcattttagttgggagggaagtttttcctgatggaattctctat
gcctcgaaggaatcccattattctgttttcaaagctgcacgaatgtaccgaatggattgt
gttatggtcaatactctggtctctggtgagattgactgtaccgattttcgagctaaactc
cttcagaacaaggacaagccagccatcatcaacgttaatattggtacaactgtcaaggga
gctgttgatgatctggatttggtcattaagatccttgaagacactggatttaaccatgac
cggttctacattcactgtgatggtgccctgtttgggctcatgatgcctttcgtgaaacgg
gcaccaaaagtcagctttaagaagcctatcggtagcgtgagcgtatctgggcacaagttt
gttggctgccctatgccatgtggggttcaaataaccaggctggaccacatcaatgccctc
tctaggaacgtcgaatatctcgcttctagggatgccaccatcatgggcagccgaaatggt
catgcacccatctttttatggtacactctcaatagaaagggctatcgtgggttccaaaaa
gaagtgcaaaaatgcttaagaaatgcccattatttgaaagattgccttagaagtgaagga
atcagtgccatgctcaacgagctgagcagtacagtggtgtttgaaaggccacaagatgag
gaatttgttcgaaggtggcagctggcttgtcaggggaacattgcacatgctgttgtaatg
ccgaatatcaccatagagaagcttgatgattttgtgaaagagttgactgcgaagaggtca
acttggttcaaggatgggaaggcccaagctccttgcattgctgatgaaattggggctgag
aattgtgcttgtgctcgtcacaactga

DBGET integrated database retrieval system