KEGG   Amborella trichopoda: 2546579Help
Entry
2546579           CDS       T02990                                 

Gene name
rbcL, AmtrCp030
Definition
(RefSeq) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
atr  Amborella trichopoda
Pathway
atr00630  Glyoxylate and dicarboxylate metabolism
atr00710  Carbon fixation in photosynthetic organisms
atr01100  Metabolic pathways
atr01110  Biosynthesis of secondary metabolites
atr01200  Carbon metabolism
Module
atr_M00165  Reductive pentose phosphate cycle (Calvin cycle)
atr_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
atr_M00532  Photorespiration
atr_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:atr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    2546579 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    2546579 (rbcL)
Enzymes [BR:atr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     2546579 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 2546579
NCBI-ProteinID: NP_904107
UniProt: Q70XZ5
Position
CP
AA seq 475 aa AA seqDB search
MSPKTETKASAGFKAGVKDYRLTYYTPDYETLATDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPPAYSKSFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALYKAQAETGEIKGHYL
NATAGTCEEMMKRAVFARELGVPIVMHDYLTGGFTANTSLAHYCRDNGLLLHIHRAMHAV
IDRQRNHGIHFRVLAKALRMSGGDHIHAGTVVGKLEGERDVTLGFVDLLRDDFIEKDRSR
GIYFTQDWVSMPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVAN
RVALEACVQARNEGRDLAREGNEVIREASRWSPELAAACEVWKEIKFEFEAMDVL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccaaaaacagagactaaagcaagcgctggattcaaagccggtgttaaagattac
agattgacttattatactcctgactatgaaaccctagctactgatatcttggcagcattc
cgagtaactcctcaacctggagttccacctgaggaagcaggagctgcagtagctgccgaa
tcttccactggtacatggacaactgtgtggaccgatggacttaccagccttgatcgttac
aaaggtcgatgctaccacatcgaacccgttgctggggaagaaaatcaatatattgcttat
gtagcttatcctttggacctttttgaggaaggttctgttactaacatgtttacttccatc
gtaggtaatgtatttgggttcaaagccctacgagctctacgtctagaggatctgcgaatt
cctcctgcttattccaaaagtttccaaggcccacctcatggcatccaagtcgagagagat
aaattgaacaagtatggtcgtcccctattaggatgtactattaaaccaaaattggggtta
tctgccaaaaactacggtagagcggtttatgaatgtctccgtggtgggcttgattttacc
aaggatgatgagaatgtgaactcccaaccatttatgcgttggagggaccgtttcttattt
tgtgccgaagctctttataaagcacaggcagaaacaggtgaaatcaaaggacattacttg
aatgctactgcaggtacatgcgaagaaatgatgaaaagggccgtatttgccagagaattg
ggagttcctatcgtaatgcatgactacttaacaggaggattcactgcaaatactagtttg
gcccattattgccgagacaatggcctacttcttcacattcatcgcgcaatgcatgcagtt
attgatagacaaaggaatcatggtatacactttcgtgtactagctaaagcattgcgtatg
tctggtggggatcatattcacgctggtaccgtagtaggtaaactggaaggggaacgggat
gtcactttgggttttgttgatctactacgtgatgattttattgaaaaagaccgaagtcgc
ggtatttatttcactcaagattgggtatctatgccaggtgttctgcccgtggcttcaggt
ggtattcacgtttggcatatgcctgccctgaccgagatctttggggatgattccgtatta
cagttcggcggaggaactctgggacacccttggggaaatgcacccggtgcagtagctaat
cgggtggctttagaagcgtgcgtacaagctcgtaatgagggacgtgatcttgctcgtgaa
ggtaatgaagttatccgtgaagctagcaggtggagcccagaactagctgctgcttgtgag
gtatggaaggagatcaaattcgaattcgaagcaatggatgtcttgtaa

DBGET integrated database retrieval system