KEGG   Amborella trichopoda: 2546580Help
Entry
2546580           CDS       T02990                                 

Gene name
rpl22, AmtrCp063
Definition
(RefSeq) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
atr  Amborella trichopoda
Pathway
atr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:atr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    2546580 (rpl22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:atr03011]
    2546580 (rpl22)
Ribosome [BR:atr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    2546580 (rpl22)
  Bacteria
    2546580 (rpl22)
  Archaea
    2546580 (rpl22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 2546580
NCBI-ProteinID: NP_904138
UniProt: Q70XX1
Position
CP
AA seq 124 aa AA seqDB search
MINKISGTEIRALAKHICMSPHKARRVIDQIRGCSYEQTLMILELMPYRVCYPVFKLVYS
AAANASHNMGLNEADSFISKAEVHGGAMMKKFKPKARGRSYPIKRPTCHITIVLKERKKS
PLVV
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgataaataaaatctcaggtacagaaatacgagcattagctaaacatatatgtatgtcc
cctcacaaagcgcgaagagttattgatcagattcgcggttgctcttatgaacaaacactt
atgatactagaactcatgccgtatcgagtatgttatcccgttttcaaattggtttactct
gcagcggcaaatgctagtcacaatatgggtttgaacgaagctgattcattcattagtaaa
gcggaagtccatggaggtgccatgatgaaaaagttcaaacctaaagctaggggacgcagt
tatccgataaaaagacccacttgtcatataactattgttttaaaggaaagaaaaaagagt
ccccttgtagtttga

DBGET integrated database retrieval system