KEGG   Aegilops tauschii (wheat D): 109731690Help
Entry
109731690         CDS       T04345                                 

Gene name
LOC109731690
Definition
(RefSeq) lysine-specific demethylase JMJ30-like isoform X1
  KO
K10277  lysine-specific demethylase 8 [EC:1.14.11.27]
Organism
ats  Aegilops tauschii (wheat D)
Brite
KEGG Orthology (KO) [BR:ats00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ats03036]
    109731690 (LOC109731690)
Enzymes [BR:ats01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.27  [histone-H3]-lysine-36 demethylase
     109731690 (LOC109731690)
Chromosome and associated proteins [BR:ats03036]
 Eukaryotic Type
  Histone modification proteins
   Histone demethylases
    109731690 (LOC109731690)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cupin_8 Cupin_4 JmjC Cupin_2 7tm_4
Motif
Other DBs
NCBI-ProteinID: XP_020146449
Position
Unknown
AA seq 409 aa AA seqDB search
MDTGEPTGTAAAAAGGEKRAMLLRQITEEGGFAFVASAEKAAAGDLRAAEAAREMAWEQL
HSGPWSEVEPAWRHAYALACLHVASLRAGDDRRAALRALDMGLIMGGDLLRAELEAAIAQ
VPANGNREGEGDGAGDAGRNVERWREGLSRNRDLGDALKVLPVKSLSCKRIERRTCISLE
TFIHDYFLRESPVILSGCIDHWPARTKWKDIKYLERIAGDRTIPVEVGKSYVCNEWRHDL
ITFSHFLKRMSSPDCSGNLTYLAQHPLFDQIKELREDIVVPEYCYAGGGELQSLNAWFGP
HGTVTPLHHDPHHNLFAQVLGRKYIRLYHASISEDLYPHMETMLSNTSQVDLDNIDVKEF
PRTEDLEFMDNILEEGDLLYIPPKWWHYVRSLSTSFSVSFWWRTSIVPS
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggacaccggcgagccgacgggtacagcggcggcggcggcgggaggagagaagcgggcg
atgctcctgcggcagatcaccgaggagggaggcttcgccttcgtggcctccgcggagaag
gcggccgcgggggacctgcgcgcggcggaggcggcgcgggagatggcctgggagcagctg
cactcggggccgtggagcgaggtggagcctgcgtggcggcacgcctacgcgctcgcttgt
ctccatgtcgcgagcctccgcgccggtgacgaccgacgcgcggcgctccgagcgctcgac
atgggcctcatcatgggtggcgacctcctccgcgcagagctcgaagcagctattgcgcag
gtccctgccaatggaaatcgcgagggcgaaggcgacggtgcgggagacgccggcagaaac
gtggagaggtggagggaagggctcagtaggaatcgagacctcggcgatgcgctcaaagtt
ctaccggtgaaatccctatcttgtaagcgaatcgagcggcggacatgcatttctttggag
acatttatacatgattactttttacgtgagtcccctgttatactcagcggctgcattgat
cattggcctgcaaggacaaagtggaaggacataaaatacctagagaggatagctggagac
cgcactattcctgttgaggttggaaaaagttatgtttgtaatgagtggaggcacgacctt
atcacattttcacattttctcaagagaatgtcgtcacccgattgttctgggaacttgacg
tatctagcccagcatccattgtttgaccagataaaagagcttcgtgaagacatagtggtt
cctgagtactgttatgctggtggtggggaactccaatcgctcaatgcttggtttggccct
catgggactgtcacaccattgcatcatgacccacatcacaacctttttgctcaggtcttg
ggcagaaagtatattagactctatcatgcttccatctccgaggatttgtaccctcacatg
gaaactatgctaagcaatacgagccaggtagatcttgataacattgatgttaaggaattc
ccaaggacagaagatcttgaattcatggacaacatattggaggaaggtgacctgctttac
atcccaccaaaatggtggcattacgtgagatccctttctaccagtttctctgttagcttt
tggtggcgcacgtcaattgttccttcatag

DBGET integrated database retrieval system