KEGG   Aegilops tauschii (wheat D): 109732673Help
Entry
109732673         CDS       T04345                                 

Gene name
LOC109732673
Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ats00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    109732673 (LOC109732673)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ats03041]
    109732673 (LOC109732673)
Enzymes [BR:ats01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     109732673 (LOC109732673)
Spliceosome [BR:ats03041]
 Complex C
  Other components
   Step II factors
    109732673 (LOC109732673)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C DEAD S1 AAA_22 AAA_19 AAA_30 T2SSE PhoH AAA_16 ATPase DUF2075 AAA_7 ABC_tran Helicase_RecD Sigma54_activ_2
Motif
Other DBs
NCBI-ProteinID: XP_020147444
Position
Unknown
AA seq 1082 aa AA seqDB search
MTKASPADAVSEGIRRLTYLSLVSKVSSELEAHLGDVQRNVAEFIVHLGRASPSVAEFDA
KLKDHDFVVPDYLARTLHTVIHAIPDAAPAPAPAPAPAPAPAPRNPTADGLSTGTRSPDD
KEEEEEEDGAGGPELHQVCHGTVIRVVDAGCFVRLDGARGREGLVHTSRMPASVKRGQEV
FVKVVSVQWGNLELSMADIDQETGRALPPPRRDGQDAVRRANRSADPAGTSGKRIGLSGI
VIEEDGARPAPRRPVRRMSSPERWELKQLIASGALNVRDCPAFDDDDWGIHYQEEEEVEE
ELEIELNEDEPPFLSGQGRSSIDLSPVRISKNPEGSLSRVAALQTALVKERRDIRSQEQR
ALLDSIPKDLNRQWEDPLPDAGGRCLAQEMRGAGLSAQSMPDWKKQAYGKTGTFGKRSSL
PIQEQRQHLPIYRLKNELIKALHHHQVLVVIGETGSGKTTQVTQYLAEAGYTEGGKIACT
QPRRVAAQSVAKRVAEEFGCPLGEEVGYSIRFDDRTGPDTVIKYMTDGMLLREIMVDKNL
SCYSVVMLDEAHERTIYTDILFGLLKQLIRRRTDLKLIVTSATLDAEKFSRYFFNCNIFT
IPGRTFPVEILYAKEPESDYMDAALITVLQIHLSQPEGDILLFLTGQEEIDQACNSLHER
MKVLGNDVPELLVNPVYSALPTEMQSKIFEPAPLGKRKVIVATNIAEASITIDGIYYVVD
PGFAKLNVYNPKRGLDSLVITPISQASAKQRAGRAGRTGPGKCYRLYTESAYRNEMPATT
IPEIQRINLGWTVLNMKAMGINELVSFDFMDPPAPQALISAMEQLYSLGALDEEGLLTKL
GRKMAEFPQEPPLSKMLLASVDLGCSDEIVTIIAMIQTGNIFYRPREKQDQADRKRGNFF
QPEGDHITLLTVYQAWKAKQFSGPWCFENFLQITSLRRAQDVRKQLLEIMDRYRLDVVSA
GNDLTKVRRAIAAGFFFNSAKKDPQGGYRTLADHQQVYIHPSSALFHQQPEWVIYNEIVM
TTKEYMREVTAINPAWLVELAPRFYRSMDSTKMSKRKRQERIEPLYDRYNEPNSWRLSKR
RG
NT seq 3249 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaggcgagcccggccgacgcggtgagcgaagggatccgaaggctcacctatcta
tccctcgtctccaaggtctcctcggagctggaggcccacctcggcgacgtccaacgcaac
gtcgccgagttcatcgtccacctcggccgcgcctccccctccgtcgctgagttcgacgcc
aagctcaaggaccacgacttcgtggtgccggactacctcgcccgcaccctccacaccgtc
atccacgccatccccgacgccgctcccgctcccgctcccgcccccgcccccgcccccgcc
cccgccccccgaaaccccaccgccgatggcctcagtaccggcaccaggagccctgatgac
aaggaggaggaggaggaggaggatggggccgggggtccggagcttcaccaggtgtgccac
gggacggtcatccgggtggtggacgccgggtgcttcgtccgcctcgacggggcgcgcggc
cgcgaggggctagtccacacctcccggatgcccgcctccgtgaagcgcggccaggaggtg
tttgtcaaggtcgtgtccgtgcagtggggcaatctggaattgtcgatggcggacatcgat
caggaaactggaagggcactcccgccaccacggcgcgatggtcaggacgctgttcggagg
gcgaatcgatctgctgatcctgccggaacctctgggaagaggattgggctgtctggaatt
gtgattgaggaggacggtgctcggcctgcaccacgaaggccggtcaggcgaatgagctcc
ccggagagatgggaactgaagcagctgattgcttcgggggcactgaatgtgagagactgc
cctgcgttcgatgatgatgattgggggatacattaccaggaagaagaagaagtggaggag
gagctcgagattgagcttaacgaagatgagccgccgttcttatctggacagggccggtcc
tcgattgacttgtccccggtgaggatttccaagaaccctgaggggtcactgagccgagtg
gcggcactgcagactgcgcttgtcaaggagcggcgtgatatccgtagccaggagcagaga
gcattgcttgattccatccccaaggatctgaatcggcagtgggaggatcctttacctgat
gcaggtgggcggtgccttgcacaggaaatgaggggcgccggcttatcagcacagagcatg
ccggactggaagaaacaggcttatgggaagacaggaacatttgggaagaggtcgagcctt
ccaatacaggagcagaggcagcaccttcccatttaccggctgaagaatgagcttatcaaa
gctctacatcaccatcaagttttggttgttatcggggagacagggtcagggaaaactacg
caggttactcagtaccttgctgaggcaggctatactgaaggtgggaaaattgcgtgtacg
cagcctcgcagggttgctgcgcagtctgttgcaaagcgggtagcagaggagtttggttgt
ccattgggagaggaagttggttattctatacgctttgacgatcgaactggacctgatacg
gtcattaagtacatgacagacggcatgctcctacgggagattatggtagacaagaacctc
tcttgttattctgtggtcatgcttgatgaggcacatgagaggaccatctatacagacatt
ctctttggcttgctgaagcagctcattaggcggagaactgatctcaagttaattgtcact
tccgccactcttgatgcagagaaattctctagatatttttttaattgcaacattttcacg
attccagggagaacgtttcccgtggagatactatatgcaaaggagccagagagcgattac
atggatgctgcattgatcacagtattgcagatccatctgagtcaacccgaaggtgatatc
ctcttgttcttgactggccaggaagagattgatcaggcctgtaactctcttcatgagagg
atgaaggtgctgggtaacgatgtaccagagttgctagtcaatccagtttacagtgctctt
ccaactgaaatgcaatcaaagatttttgaacctgctcctcttgggaagaggaaggtgatt
gtggccaccaacatagccgaagcatctattacgatagatgggatatactatgttgttgat
ccaggctttgcaaaactcaatgtgtataatccgaaacgaggactggattcactggttatc
actccgatctcacaggcatcagctaaacaaagagcaggacgtgctgggcgtacgggccca
ggcaagtgttaccgtctgtacactgagagcgcctatcgtaatgaaatgcccgccacgact
attccagaaattcagaggattaacctggggtggacggttcttaatatgaaggcaatgggg
ataaatgaactagtgtcattcgacttcatggaccctccagcacctcaagcgcttatctct
gctatggaacagctgtacagccttggtgccttggatgaagaaggcctgcttaccaagctg
gggagaaagatggctgagtttccacaagaaccgccactttcaaaaatgctccttgctagt
gtggacctcggatgcagtgatgaaatagtgactatcattgcaatgatccaaactggcaat
atattctaccggccaagggaaaaacaagatcaggcagatcggaagaggggcaactttttc
cagccagaaggggatcacatcacgttactcactgtgtatcaggcgtggaaggcaaagcag
ttttcagggccatggtgcttcgagaattttctccagataacatcactaaggagggcacag
gatgtgaggaagcagctcctggagatcatggacaggtatcggcttgacgttgtctctgcc
ggcaacgatctcaccaaggtaaggagagccatcgccgcaggcttcttcttcaactctgcc
aagaaggatccccagggaggatacaggacacttgccgatcatcagcaggtgtatatccac
ccaagcagcgccctctttcatcagcagccagagtgggtgatttacaatgagattgtcatg
accacaaaagagtacatgagggaggtgacagccatcaacccagcgtggctcgtcgagctg
gcaccgaggttctacagatccatggattcgacaaagatgagcaagcggaagcgccaggag
aggattgagcctctgtacgacagatacaacgagcccaactcgtggcgcctcagcaagcgc
cgtgggtga

DBGET integrated database retrieval system