KEGG   Aegilops tauschii (wheat D): 109732723Help
Entry
109732723         CDS       T04345                                 

Gene name
LOC109732723
Definition
(RefSeq) putative 1-phosphatidylinositol-3-phosphate 5-kinase FAB1C
  KO
K00921  1-phosphatidylinositol-3-phosphate 5-kinase [EC:2.7.1.150]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00562  Inositol phosphate metabolism
ats01100  Metabolic pathways
ats04070  Phosphatidylinositol signaling system
ats04145  Phagosome
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109732723 (LOC109732723)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    109732723 (LOC109732723)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109732723 (LOC109732723)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ats04131]
    109732723 (LOC109732723)
Enzymes [BR:ats01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.150  1-phosphatidylinositol-3-phosphate 5-kinase
     109732723 (LOC109732723)
Membrane trafficking [BR:ats04131]
 Endocytosis
  Macropinocytosis
   Kinases
    109732723 (LOC109732723)
 Endosome - Golgi transport
  Others
   Others
    109732723 (LOC109732723)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIP5K Cpn60_TCP1 baeRF_family5
Motif
Other DBs
NCBI-ProteinID: XP_020147497
Position
Unknown
AA seq 1601 aa AA seqDB search
MGVPVARKSDSWVTDLAMTDCGGGDRSDLGVRPINGGRGAAMEQRGDGLDGATMSPPERV
PTPSSSRSAGWRRFSSPGPLRCSTPGSIGYEDGDDSDRDRYFSPGSEFSQDTSDTDSVST
NISRLYTFRLGNSSPLYSPMRRSGQVGTSPPSGINGHASQNSPIYSLNSGHGYDDGDYLM
DSPNCDDEHHDNIIQPIDFESNNGLIWHPPPPQDEGDDSENGFFQYDDDDDDSAIGDGKT
FERVNHECGGSEDLPGTKGKQNIAHKEFLRNALHGHFRALVSQLLQGHGVDLVDGWSDIV
SLLAWQAATFVQPDTSKGGSMDPTNYVKVKCVASGTPNDSTFIKGVVCSKNVKHKRMVSK
HENPRILLLGGALEHQKVTNKLASINSILEQEKEYLKNAVAKIEAQRPHVLLVEKSVPMY
AQQLLAKDISLVLNVKRSLLERISRCTGAKIASSIDNITSARLGQCQAFWIERVAESLAP
KDSNRKSIKTLMFFDGCPRRLGCTVLLRGTSYEELRKVKLALQFAVFAAYQLSLETSYLA
DEGATLPKTPSDLPVRPLEKHMNGGDISSSNSRQNLNNFQIIGDRTSEKGCIVPLNFLDG
SSKVLTIDQSLLKPNLGQEEYIPGTDDTFSHPPTLFIDNDCESPLVGKGTPADLQYPDDV
HRDEMVGGIYRVESELDNGCHHTSDEEHAGVTIPDHNENPTEYFPTSENAQSILVSLSVA
CPQKRIVCKQSQLFRIKFYGNFDKPLGRYFREDLFYQTSCCESCKEPAESHVQCYTHQQG
SLSIGVRNLESVKPLPGRNDGKIWMWHRCLRCKQKNGNPPATHRVVMSDAACGLSFGKFL
ELSFSNHTTANRVACCGHSLQRDCLRFYGFGSMVAVFRYSPVDILSVNLPPSVLDFAYPV
AQDWLIEEAGDVANRKDNFYRVIFDNLDCIEKTVSAQEDVSMKAGLYKHVVDLKDLIKVE
WKKYDVLSGFGSIQKLQTIGEPVDVLELNRLRRELVLDAHVWDRRLHMMHSLTKKNCTAA
TDAQCPKKFPESVLEDSKAEISSTQENMEKSLEYSQSSSFITDSGKPLLRREHGGTTVSH
SGLTNIDEVYHQSVEGSASSAGLHIVPHPCEVQSNGVVADELKLEKTLEKSESSPSNLSD
RIDLAWTGSGVETLLVAPTALMNGSSYQNVMAPIRIKSFDSGINFRNGLSPVDDSNVSIR
RAYSQRPPRALERTGRGLSPIFTNKLSLPGMVDGEGRFLLSQSVSDVVVPVYDDEPSSMI
AHAMTVPEYRSFMLPVLNLHNELDRPSVLNSLDQNSTSRSWSDVSQMNSKDIHLTVSFED
EDSCSVDKAKFSVICYFAKQFDSIRKKCCADELDYIRSLSRCKRWSAQGGKSNVYFAKTL
DDRFVIKQVTRTELDSFEDYATEYFKYITESVSSGSPICLAKVLGLYQVVAKNMKDGKEL
KMELMVMENIFFKRKVSRIYDLKGSLRSRYNPDTSGNNKVLLDLNLLETLHTKPIFLGSK
AKRRLERAVWNDTSFLASVGVMDYSLLVGIDEEKKELVMGIIDYLRQYTWDKQLETWVKA
SGILGGSKDGMPTIISPDQYKKRFRKAMSKYFLTVPDQWSP
NT seq 4806 nt NT seq  +upstreamnt  +downstreamnt
atgggagttcccgtcgcgcggaagtccgattcttgggttaccgaccttgcgatgacggac
tgcggcggcggcgaccgctccgacctcggcgtccggcctattaacggtggccgaggtgcc
gccatggagcagcgcggtgacgggttggatggggctacgatgtccccaccggagcgtgtc
ccgacaccgtcttcctcgaggtctgctgggtggcggcgtttctcctcacctggtcctctc
cgatgctcaacgccagggagtattggttatgaagacggtgatgactcagaccgagaccgg
tatttctccccgggcagtgagttttctcaagatacttctgatacggattccgtgagcaca
aatattagtaggctgtacacattcaggttgggaaattcgagcccgttatatagtcctatg
agacgatcgggacaagtaggcacaagtcctccctccgggataaatggtcatgccagccaa
aattctcctatatactctttgaattctggccatggctatgatgatggtgattatttgatg
gattcaccgaattgcgacgatgaacatcatgacaatattatacagccaattgattttgag
agtaataatggactcatatggcatcctccgccgcctcaagatgagggtgatgactccgaa
aacggtttctttcaatatgatgacgacgatgatgacagtgctattggtgatgggaagacc
tttgaacgtgttaaccatgagtgcggtggtagtgaggatttaccagggaccaaaggaaaa
cagaatatagctcataaagagttcttaaggaacgctttacatgggcatttcagggctctt
gtgtcccaattgctccaaggtcatggagttgacctcgtggatggatggtcggacatagta
tccttattagcatggcaggcagctacctttgtgcagccagatacaagcaagggtggtagc
atggatcccaccaactatgtcaaagttaaatgcgtagcatcagggactcccaacgatagt
actttcattaaaggcgttgtttgttctaagaatgtaaaacataaacgcatggtgtcaaag
catgagaatcctagaattcttcttttgggaggagcactggaacatcaaaaggttacaaac
aaactagcatcgataaacagcattcttgaacaggaaaaggaatatcttaagaatgctgtt
gcaaagatagaggcccaacggcctcatgtcttgttggttgaaaagagtgtgccgatgtat
gctcaacagcttcttgcaaaagatatatctttagtactgaatgtcaagagatcacttcta
gaacggatatcacgctgcacaggtgctaaaattgcttcatccattgacaatatcacttca
gcaagacttggacaatgccaagctttctggattgaaagagttgcagaatctttagctccg
aaggactctaacagaaaatctatcaagacactgatgttctttgatggttgtccaagacgc
ttgggctgcacggtcctcctaaggggcacatcctatgaagagttaaggaaggtcaaactc
gctctgcaatttgctgtatttgcagcatatcaactatcactggagacttcatatcttgca
gatgagggtgcaacactaccaaagaccccttcggatcttccagttcgtccacttgagaag
catatgaatggtggagatatttcctcaagtaattctcggcagaatttgaataattttcaa
atcattggtgacagaacttcagaaaagggctgcatcgtgcctctaaatttccttgatggt
tcttcaaaagtgttaactattgaccaatcccttttgaaacctaaccttggtcaggaagaa
tacattcctggaactgatgacacgttttctcatcccccgacattgtttatcgataatgat
tgtgaatcacctctagttggaaaagggacaccagcagatttgcaataccctgatgacgtt
catcgagatgagatggttggtgggatttatagagttgaaagtgagttggacaatggttgc
catcatacatcagacgaagaacatgcaggagtaaccatacctgatcataacgagaacccc
accgagtatttcccaacatccgagaatgcacagagcattttggtttccttgtccgttgca
tgccctcagaaaagaattgtatgcaagcaatctcagctcttccgcataaagttctacggt
aattttgataagccacttgggaggtattttcgtgaagatttattttatcagacttcatgc
tgtgagtcttgcaaagaacctgcagaatctcatgtccaatgttatactcatcaacaaggc
agtctttcaataggtgttagaaatcttgaatctgtaaagccgttacctggacggaatgat
gggaagatatggatgtggcacaggtgcctccggtgcaaacaaaaaaatggaaaccctccg
gcaacacacagagtagtgatgtctgatgcggcatgtggactttcttttgggaagtttctt
gaacttagcttttcgaatcacacaacagccaatcgagttgcctgctgtggacattccctc
cagagggactgtcttcgtttttatgggttcggaagcatggttgctgtcttccgttattct
cctgtggacatcctatctgtcaacttgccaccctcagtattagactttgcttatccagta
gcacaagattggctcatcgaggaggctggtgatgtagccaataggaaggataacttttac
agggtgatttttgacaatcttgactgcattgaaaagacagtttcagcccaagaagatgtg
agcatgaaggcgggcttgtataaacatgttgttgatcttaaagatctgattaaagttgag
tggaagaaatatgacgttttgtcggggtttggtagcatacagaagttacaaacaattgga
gaacctgtagatgttctagagctcaaccgcctgaggcgagagcttgtacttgatgcacat
gtatgggatcgccgtctgcacatgatgcactcactcaccaagaaaaactgtactgcggca
actgatgcacagtgtcctaagaaatttcctgaaagcgtgttagaagattcaaaggctgag
atttccagcacacaggaaaatatggagaagtcactagaatattctcagtcaagttctttt
atcacagatagtgggaagccattgctcagaagagaacatggtggcacaactgtgtcacat
tctgggttgaccaacatagatgaagtataccaccagtctgttgaaggctctgctagttct
gctggtctccacattgtcccgcacccatgtgaagtacagagcaatggggtggtggctgat
gaacttaagcttgagaagacattggagaagtcagagtcttctccatcaaatctttctgat
agaattgacttggcatggactggctctggcgtggagacacttctagtcgcacctactgct
ctgatgaatggctcctcataccagaatgttatggctccaattagaattaaatcatttgat
tctggaatcaatttcagaaatgggttatcacctgtcgacgattcaaatgtaagcataaga
agagcttattcccaaaggcctcctagggcgcttgagagaacaggcaggggtttgtccccg
atcttcacaaataagctgtcacttcctggtatggttgatggtgagggccgtttccttcta
tcacaaagtgtttcagatgttgttgttccagtgtatgatgatgagccgtccagtatgata
gcccatgccatgactgttccagaatatcgtagtttcatgttgccagtgctgaatctgcat
aatgaattggacagacctagtgttttgaactctctggatcagaattctacttctagaagc
tggtcagatgtatctcaaatgaattccaaggatattcatttgacggtttcttttgaggat
gaagactcatgttctgtggataaggcaaaattttctgtcatatgttattttgcaaagcag
tttgattcaatcagaaaaaagtgttgtgcagatgaattggattacattcgttctttgagc
cggtgcaagagatggagtgctcaaggtggcaagagtaatgtatactttgccaagacactg
gatgacagatttgtcataaagcaagtgacacggacggaattagattcatttgaggactac
gcaaccgagtacttcaaatatataacagagtctgtatcctctggaagcccaatttgcctt
gctaaagttcttggtctttaccaggtcgttgccaagaacatgaaagatggaaaggaactg
aagatggaattaatggtcatggaaaacatatttttcaagaggaaggtatcaagaatatat
gacctgaaaggatccctgcgttcccgttacaaccctgatacatcaggaaacaacaaggtt
ctcttagatctcaatctattagagacacttcatacaaaacccatttttcttggaagcaaa
gcaaaaagaaggttggaacgagctgtctggaacgatacttcttttctggcatcggtgggt
gtgatggactactccctcttggttggcatcgacgaggagaagaaagagctggtgatggga
atcattgactatctccgccagtacacgtgggacaaacagctggagacctgggtgaaggcg
tcggggattctggggggctccaaggacgggatgcccaccatcatttctccagaccagtac
aagaagaggttcaggaaggccatgtcaaagtacttcctgactgtccccgaccaatggtca
ccttga

DBGET integrated database retrieval system