KEGG   Aegilops tauschii (wheat D): 109734685Help
Entry
109734685         CDS       T04345                                 

Definition
(RefSeq) uncharacterized protein LOC109734685
  KO
K06195  ApaG protein
Organism
ats  Aegilops tauschii (wheat D)
Brite
KEGG Orthology (KO) [BR:ats00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    109734685
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF525 UVR DUF4354
Motif
Other DBs
NCBI-ProteinID: XP_020149472
Position
Unknown
AA seq 293 aa AA seqDB search
MQWVGLSSPPAAPTAVWMRRRPRTTRWPQSSSAARRAVVAAASSSPPSSDANSSSNSPGS
DEEAEEAAGKAEGDKTAAAFLLRSQKYAMLKQQLAVAAQLEDYKEAARLRDSLRLFEEEE
PVLRLRRSLKKAVEEERFADAAKYRDELMILAPHSLLKCSSDATTLGIRVQVRSVYIESR
SQPLKGKFFFAYRIRITNNSQRAVQLLRRHWIVTDANGRTENVWGVGVVGEQPVIFPKTG
FEYSSACPLNTPNGRMEGDFEMKHIDKVGSSTFNIAIAPFSLSILGDDNDAPL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgggtgggcctgagctcgccgccggcggcgccgacggcggtatggatgcggcgc
cgtccaagaacaacgagatggccgcagagctcgtccgccgcacggagggcggtcgtggcg
gccgcgtcctcgtccccaccgtcatccgatgccaactcgagctccaactcgccgggtagt
gacgaggaggcggaggaggccgcggggaaggcggagggtgacaagacggcggcggccttc
ttgttgaggagccagaagtacgctatgctcaagcagcagctcgccgtagccgcccaactc
gaggattacaaggaggcggcgaggctgagggactcgttgaggttgttcgaggaagaagag
cccgtcctccgcctccgccgctcgctgaagaaggcggtcgaggaggagaggtttgcggat
gctgccaagtacagagatgaactgatgattttggctccgcactccctcctcaaatgttct
agtgatgctacaactctggggataagggttcaagtcaggagtgtctatattgaaagccgg
agccaacccttaaaggggaagttcttttttgcctacagaatcagaattacaaataattct
cagcgtgctgtacagcttctcagacgacactggattgtcactgatgcgaatggaaggaca
gagaatgtttggggtgttggtgtagtgggagagcaacctgtgatattcccaaagacgggt
tttgagtactcatccgcatgcccactaaacactccaaatgggagaatggaaggtgatttt
gagatgaagcacattgacaaggttggatcctcgacattcaatatcgctatcgcaccattc
tctctgtcaatcctcggggacgacaacgacgctcccctctga

DBGET integrated database retrieval system