KEGG   Aegilops tauschii (wheat D): 109734735Help
Entry
109734735         CDS       T04345                                 

Gene name
LOC109734735
Definition
(RefSeq) fructan 6-exohydrolase-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00052  Galactose metabolism
ats00500  Starch and sucrose metabolism
ats01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109734735 (LOC109734735)
   00500 Starch and sucrose metabolism
    109734735 (LOC109734735)
Enzymes [BR:ats01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     109734735 (LOC109734735)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: XP_020149510
Position
Unknown
AA seq 576 aa AA seqDB search
MAGLPLAACVLAFHLCLLLLLSSSLPAVVDHGVGIRPAYHFLPAKNWQNDPNGPMYHKGV
YHLFYQYNPLGAMWGTGNLSWGHSVSRDLVNWVALHTALDPTAPFDANGCWSGSATVLPS
GVPALLYTGIDAHKVQVQNVAFPKNPADPFLREWVKPSYNPVILHPADVPGDSFRDPSTA
WIGSDGMWRIAVAAKVGGPMGIASALVYRSKELRRWKRNASPLYTSRAAIMVECPDLFPV
VRPDTEEGRLDYASIAATGAVRHVLKLSVMNTTQDYYAVGRYDDTADTFTPQEDVERNID
DCRTWRRIDYGHVYASKSFFDAGKNRRVLWAWANESDSQADDIARGWSGVQTVPRKVWLD
GDGKQLRQWPIEEIETLRRKQVISLLGAQVNAGGINEIVGAGAQADVEAVFEIPSLEEAE
SFDPIWLLDPQKLCADKGASAFGLLVMASSDLREYTSVFFRVFKYNQKYKVLMCTDLTRS
TTRANVYKPSYGGFVDMDIEEHKRSISLRTLIDHSMVESFGGGGRTCITARVYPKHVEKS
DSHMYLFNNGTGVVKVSRLEAWKLATATINAVPRGS
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggccggactccctctcgccgcgtgcgtcctcgccttccacctctgccttctcctcttg
ctgtcctcttcactccccgcagtagtcgaccatggcgtgggcatcaggcccgcttaccac
ttcctgcccgccaaaaactggcagaacgatccgaatgggccaatgtaccacaagggtgtg
taccacttgttctaccagtacaacccgcttggcgcgatgtggggcaccggcaacctctcc
tggggtcactccgtctcccgcgatctcgtcaactgggtcgcgctccacaccgcgctcgac
cccaccgcccccttcgatgcgaatggttgttggtcaggctccgccaccgttctcccgagc
ggcgtcccagccttactatacaccggcatcgacgcccataaggtgcaggtgcaaaacgtc
gccttccccaagaaccctgctgacccattcctccgcgagtgggtgaagcccagctacaac
cctgtcatcctgcacccggccgacgtccccggcgacagcttccgtgacccttcgacggcg
tggataggcagcgacggtatgtggcgcatcgccgttgcagccaaggtcggcggccccatg
ggcattgcctccgcccttgtctaccggagcaaggaattacggcgctggaagcggaatgcc
tcaccgttgtacacgtcacgcgccgccatcatggttgagtgcccagacctgttcccagtg
gtgaggccggacacggaggaggggcggctcgactacgcatccattgcagcgaccggtgct
gtgaggcacgtgctgaagctgagtgtgatgaacacgactcaagactactacgcggttggg
aggtatgacgacacggcggacaccttcacgccacaggaggacgtggagcgcaacatcgat
gattgtcgaacttggcgtcgtatcgactatggccatgtgtatgcatccaagtccttcttt
gacgcagggaagaaccgacgcgtgttgtgggcgtgggccaacgagtccgatagccaggcc
gacgatattgctaggggctggtccggcgtccagacggttccgaggaaggtgtggctagac
ggcgatgggaagcagcttcgacagtggccgattgaggagatcgagacgctgaggaggaaa
caagtcatcagcttgctcggagcgcaagtgaacgccggtggcattaacgagatcgttggt
gcaggcgcacaagctgatgtggaggctgtctttgagatcccttccctggaagaggccgag
agcttcgaccccatctggctgttggacccgcaaaagttgtgcgcggacaagggtgcgtct
gcatttgggctactcgtcatggcctctagcgacttgcgtgagtacacatccgtcttcttt
agggtgttcaaatacaatcagaagtacaaagtcctcatgtgcactgacctcacaagatcg
actacgagggccaatgtgtacaagccatcgtacggaggctttgtggacatggacatcgag
gagcacaagaggagtatatctcttagaacattgattgaccattcgatggtagagagtttc
ggaggaggggggcgcacatgcatcacggcacgtgtttaccctaagcacgtggagaagagc
gatagccacatgtacctgttcaacaacggaaccggtgttgtgaaggtgtccaggctcgaa
gcatggaagctggcaacggcgaccataaacgccgtccctcgtgggtcataa

DBGET integrated database retrieval system