KEGG   Aegilops tauschii (wheat D): 109736781Help
Entry
109736781         CDS       T04345                                 

Gene name
LOC109736781
Definition
(RefSeq) probable serine/threonine-protein kinase PBL28
Organism
ats  Aegilops tauschii (wheat D)
Brite
Enzymes [BR:ats01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109736781 (LOC109736781)
Protein kinases [BR:ats01001]
 Serine/threonine kinases: TKL group
  IRAK family
   109736781 (LOC109736781)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PP2 APH FTA2 Kdo Pkinase_fungal YrbL-PhoP_reg Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-ProteinID: XP_020151573
Position
Unknown
AA seq 475 aa AA seqDB search
MDDDQARELRALERILSDPSVEPTMLSYGILKYITNSFSNEIGRGGFGVVYQGDLENWVV
AVKIFKTHNADRQFLDEIRCLKIANHKNIVRFLGYCSDIQEEVRTSDGVPVLAGHYKRLL
CFEYVPKGNIRQYLQQEKPHQEDWPARYKMIRGICQGLHYLHDKQIIHRDLKPENVMLDA
QMEPKITDFGLSRFLDQGTSTLLTSHIAGTLRYIAPESKDNGEVSLKSDIYALGVIMVEL
LSGMSMISLLHQWDKYIDMSLPRVRGCTELARNCMDQDKHQRPTVREVIRDLDNLESMFP
WSSISQSRPMGPESTVVKLPSRSLTIAWVDNPEYWRWTSRRDSRFGECAELLRVYYLKVS
RLITPKDLPAATTSYTAYLVYKRAGSTLEGIVQTASTLHFDNIIASSKVSLHPKEGGPSS
AHGVTYPVTRGDGWLELRPGEFSNEKAVTVQLLHEDPNKEMSGLIIDGMEVRRSL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggatgatgatcaagcacgtgaactgagagctctagaacgcatactgagtgatccaagt
gtggagccaaccatgctatcttatgggatactgaaatacattacaaattctttttctaac
gagattggtcgtggtgggtttggagttgtgtaccagggagatttggaaaactgggtagtc
gctgtgaagatcttcaagacacataatgcagataggcaattcctagatgagatcaggtgt
ttaaaaattgcaaatcacaagaatatagtaagatttctgggctattgttcagatatacaa
gaggaagttaggacatccgatggagtacctgtgctggcagggcattataagaggttgctc
tgtttcgagtatgttcctaaaggaaatattcgacagtatcttcaacaagagaaacctcat
caagaggactggccagcacgctacaaaatgattagaggaatttgtcaagggttgcactat
cttcatgacaagcaaattatccatcgtgacttaaaacctgaaaatgtaatgttggatgct
cagatggaaccaaaaattactgattttggtttgtcgagattcttagaccaaggaacatcc
acattgcttacttcacacatagctggaacattgagatatattgcaccagaaagcaaagat
aatggagaagtatcactaaagtcagacatatatgctttgggtgttattatggtggagcta
ctatctggcatgagcatgataagtctgttgcatcagtgggataaatatatagacatgagc
ctcccacgagtgagggggtgcaccgaattagctcgaaactgcatggaccaagacaaacat
cagagacccacagtacgtgaagtaattcgcgacctggacaatctggagagcatgtttcca
tggtcttccataagccagagtcgtcctatggggccggagagcaccgtcgtcaagctacca
tcgaggtcattaactattgcatgggttgacaatcccgagtactggagatggacctcacgc
cgggactccaggtttggcgaatgtgcggaactcttacgtgtgtactatctgaaggtctct
cggctgatcacacccaaggacctgcctgccgccaccacaagctacacggcttacctcgtg
tacaagcgggctggcagcaccctggaaggcattgtgcagacagcgagcacgctccatttc
gacaatatcattgctagcagcaaggttagccttcaccccaaagagggcgggccaagtagt
gcccatggtgtcacctaccctgtcaccaggggcgatggctggctggagcttagaccgggg
gagttctctaacgagaaagcggtaactgtacagctcctccatgaggacccgaacaaagag
atgagcggcctcatcattgatggcatggaggtcaggaggagcctgtaa

DBGET integrated database retrieval system