KEGG   Aegilops tauschii (wheat D): 109737893Help
Entry
109737893         CDS       T04345                                 

Gene name
LOC109737893
Definition
(RefSeq) G-type lectin S-receptor-like serine/threonine-protein kinase At1g34300
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
ats  Aegilops tauschii (wheat D)
Brite
KEGG Orthology (KO) [BR:ats00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ats01001]
    109737893 (LOC109737893)
Enzymes [BR:ats01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109737893 (LOC109737893)
Protein kinases [BR:ats01001]
 Serine/threonine kinases: TKL group
  IRAK family
   109737893 (LOC109737893)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr ABC1 APH
Motif
Other DBs
NCBI-ProteinID: XP_020152609
Position
Unknown
AA seq 443 aa AA seqDB search
MSTTPFPFPTDNAPPSFGDDFNKQVSRTTNSFLTIIVVVSVLSILGSVAIVYFVYRCVKK
NGLPAININTTSPAPAGSTTLYAVVPDSQIRDATVERFLKEIAGEKPIRFTPQQLSGFTN
NYSARLGAGGFGAVYKGMLPNGLMVAVKRLHPGHDDRTSQEQFMAEVGTIGRTHHINLVR
LFGFCYDAGVRALVYEYMEHGALDSYLFDRSRYVGFQTLRAIAVGVARGLRYLHEECQQK
IVHYDIKPGNVLLDGGLTPKVADFGLAQLLNRADTHKTVSGMRGTPGYAAPEMWMQAGAT
EKCDVYSFGILLFEILGRRRNFDEAAPESQQWFPKLAWTKYESGELMEVVASCDGACEED
KKAAHRMCEVAFWCVQQQPEARPPMGVVVKMLEGEMDIAPPANPFQHLMATPAAANLWTT
GTSTVNSVSTSANGVPRGSDEIV
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccacccccttcccgttccccactgacaacgcaccaccatcattcggcgacgat
tttaacaaacaagtctccagaaccaccaactcattccttaccatcatcgtcgttgtttcg
gtgctgagcatcctgggatccgtcgccatagtctacttcgtgtacaggtgcgtcaagaag
aacggcctcccggccatcaacatcaacaccaccagccccgcgccggcggggagcacgacg
ctgtacgctgtggtgccggactcccagatacgggacgccaccgtcgagcggttcctcaag
gagatcgccggcgagaagcccatccggttcactccgcagcagctctcgggcttcaccaac
aactactccgcccggctcggcgccggcggcttcggcgcagtctacaagggcatgcttccc
aacggcctcatggtcgccgtgaagcgcctccaccccggccacgacgacaggacctcgcag
gagcagttcatggcggaggtgggcaccatcgggaggacgcatcacatcaacctggtcagg
ctgttcggcttctgctacgacgccggcgtgcgcgcgctggtgtacgagtacatggagcac
ggcgcgctcgactcgtacctcttcgaccggagccgctacgtcggcttccagacattgcgc
gccatcgccgtcggcgtcgccagggggctccggtacctccacgaggagtgccagcagaag
atcgtgcactacgacatcaagcccggcaacgtcctcctcgacggcggcctcacgcccaaa
gtggccgacttcggcctcgcgcagctgctgaaccgggcggacacgcacaagaccgtctct
gggatgcgcggcacgcccgggtacgccgcgccggagatgtggatgcaggccggcgccacc
gagaagtgcgacgtctacagcttcggcatcctcttgttcgagatcctcggccggaggagg
aacttcgacgaggccgcgccggagagccagcagtggttcccaaagctggcgtggacgaag
tacgagagcggcgagctaatggaagtcgtggcgagttgtgacggcgcgtgcgaggaagac
aagaaggcagcgcataggatgtgcgaggtggcgttctggtgtgtgcagcagcagccggag
gcgaggccgccgatgggtgtggtggtgaagatgctcgagggcgagatggacattgctccg
cccgcgaacccgttccagcatctcatggcaacgccggcggcggcgaacctgtggaccacg
gggacgagcaccgtgaactcagtgtcgacctcggcaaatggtgttcctcgtggtagcgac
gagatcgtttaa

DBGET integrated database retrieval system