KEGG   Aegilops tauschii (wheat D): 109738466Help
Entry
109738466         CDS       T04345                                 

Gene name
LOC109738466
Definition
(RefSeq) ATP-dependent RNA helicase DEAH12, chloroplastic-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ats00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    109738466 (LOC109738466)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ats03041]
    109738466 (LOC109738466)
Enzymes [BR:ats01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     109738466 (LOC109738466)
Spliceosome [BR:ats03041]
 Complex C
  Other components
   Step II factors
    109738466 (LOC109738466)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C IBR OB_NTP_bind HA2 DEAD zf-RING_UBOX zf-C3HC4_2 AAA_22 ABC_tran RRM_1 AAA_19 AAA_30 Helicase_RecD AAA_29 gp37_C zf-Nse
Motif
Other DBs
NCBI-ProteinID: XP_020153151
Position
Unknown
AA seq 1746 aa AA seqDB search
MRQSNHCRPFRPPDWGSPPPHCRPHHQQSHRQPQSAPRFAVILFRAGPNISTPTATEIDA
LVADLPSPPPDNLSVFSSGRDAARLLFRFLPAAAAAARELWSLRLEGLHLLTPYLPNAAL
AAHAFPLIASLFASHASRLLDTDLVSRSAARSAELAASIQSLEHRLRSRNSVRDFDQLHL
QKKTLEAEKDLVDAKIAEYKASMSSIRRAMLRGTDDEEEEGVDVFGIGEREDVDFARLHM
MMLRECRRLNEGLPIYAYRRKILNHIFNNQVMILIGETGSGKSTQLVQFLADSGLAANGS
IVCTQPRKIAATSLARRVDEESNGCYEDNFVLSYSTFLNSQDLNSKIIFCTDSCLLHHCM
NDTGLDGISYIIVDEAHERSLNTDLLLALIKKKLLDRLDLHLIIMSATADADKLADYFYG
CQTFHVKGRNFPVEINYVPDVSVEASSNAVPNSMCDACATASYVNDVVRMVSIIHKNEEE
GAVLAFLTSQLEVEWACENFSDASAVVLPMHGKLSHVEQSRVFKSYPGKRKIIFCTNMAE
TSLTIKEVKYVVDSGLAKESRFVPSSGLNVLKVNWISQSSANQRAGRAGRTGAGKCYRLY
SEADFSMMDVHQEPEIRKVHLGTAVLRILALGVKDARKFEFVDAPNPEAISMAVKNLEQL
GAVKHRLNCFELTDTGRYLVKLGIEPRLGKIMLDCFDVGLRKEGVVLAAVMANSSSIFCR
VGTDEEKHKADLQKVRLCHRDGDLFTLLAVYKKWEDGHDNRNMWCWQNSINAKTMRRCQE
TISELENCLKHELNIIIPSYWRWNPEAPTVHDKDLKRIILSSLTGNLAMFLGHERFGYQV
ISTGQVVNLHPSSSLLNYGIKPEWVVFTEILSVPNQYLVCVTAVDHDALYTIHPVSFIQH
LEEQKLQIKVISGLGTNLLRRFCGKYGQNQQKIISRLKEDCRDDRITVEINFQNNEVVLF
ATEQNMEKVFCTVNSALKCEGKILRNECLERNLFPGRPGSSPIALFGSGAEIKHLELGGR
YLTVEVLHQNAHDIDDKELIFLVDSIVSGVANFHKSTGSFRIASDGIKWGKFTFLKPENA
EDAVSKLNGIEFNGSSLKLVPVCTSDNRGLPFPAVRAKLCWPRRYSSGRALVTCASGEAE
FVVNDCFALGIGGRYIKCRVSTKYENCVFAEGIPMHVTEPELYDAFRSTTARRILNIRLL
RVKGNAIASPSVSTCEEELVREISPFMPNKSFPGQNFRVEVFPPEENDSLTRATITFDGS
LHREAARALDHLEGHFLPCCQPWQIIQCNHVFHSTLSCPVRVYNVISQEVASLLESFQSQ
KGVSYNFEKTENGIFRLKLTANATKTIADLRRPLEILMKGKTINHPDLTLSAVQLLLSRD
GVAHLKSIEQETGTYIMYDRQSLNIKVFGHQEQMAAAEVKLVHALRQLLEKKPLEICLRG
HNLPPDLMKKTVENFGVDLEGFNKEMPEIKVELHQHRHLLKVWGSKEDKRRVERMIFELA
SFKHSSLVQLASENVGGKEDNQRVDYSEPSEDACPICLCEIEDPFRLESCGHMFCLACLM
DQCESAMKSHDGFPICCLKTGCKEPLLVVDLKHLLSNEKLEDLFRASLRAFVASRAGMYR
FCPTPDCQSIYQVAAPDAETKPFSCGACYVEICTKCHFEYHPFISCEAYKEYKEDPDSTL
LEWRKGKANVKSCPSCGYTIEKADGCNHVECRCGSHICWVCLENFRSSEECYGHLRSVHQ
SFVDIV
NT seq 5241 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaatccaatcactgccgccccttccgcccgccggactggggttctccgcctccg
cactgccgcccgcaccaccagcagagccaccgccagccgcaatcggccccgcggttcgcc
gtcatcctcttccgcgcgggccccaacatctccaccccgaccgccactgagattgacgcg
ctcgtcgccgatctcccctcgccgccccccgacaacctctccgtattctcctccggccgc
gacgccgctcgcctcctcttccgcttccttcccgccgccgcggccgcagcgcgcgagctc
tggtcgctccgcctcgagggcctccacctcctcacgccctacctccccaatgccgcgctt
gccgcccacgccttcccactcatcgcctctctcttcgcctcccacgcctcccgcctcctc
gacaccgacctcgtttcccgttctgccgcccgctctgctgagctcgcagcctccatccag
tctctggaacaccgcctgcgcagtcgcaattccgtccgcgacttcgaccagctccatctc
cagaagaaaacattggaggccgagaaggacttggtagatgccaaaattgccgagtacaaa
gcatcaatgagttccatacggcgtgccatgttacgtgggaccgatgatgaggaggaggag
ggggtggatgtgtttgggattggggaacgcgaggatgtggacttcgcgaggttgcacatg
atgatgcttcgtgaatgcaggagactcaacgaggggctaccaatttatgcataccgcaga
aaaattctcaatcacatttttaataatcaggttatgatcttaattggggagactggttct
gggaaaagcacacagttagttcagtttcttgctgactcaggtcttgctgctaatggctca
attgtctgtactcaacctcgaaaaattgctgccacgtcattggcacgtagagtggatgaa
gaaagcaacggctgctacgaagacaatttcgtgttgtcatattcaacctttttaaattct
caagacctcaattcgaagatcatattttgcacagatagttgtcttttacatcactgcatg
aacgacacgggcctggatggcatttcatatatcattgttgatgaagctcatgaaagaagc
ttgaacactgatcttcttttagccttgatcaagaagaagctgcttgataggttggatttg
catctcattataatgtctgccactgctgatgctgacaaacttgctgactacttttatggc
tgtcaaacattccatgttaaagggcgaaattttcctgttgaaattaattatgtcccagat
gtatcagtggaggcttcctccaatgctgtgccaaactctatgtgtgatgcttgtgcaact
gcttcttatgtcaatgatgttgtaaggatggtaagcatcattcacaagaatgaagaagag
ggtgctgtccttgctttcttgacatctcagctggaagttgaatgggcttgtgaaaatttc
agcgatgcaagtgccgtggtacttcctatgcatggaaagctttcccatgtagaacagagc
cgtgtttttaaaagctatcctggaaagagaaaaattatcttctgcacgaatatggctgaa
acatcactgacaataaaagaagtaaagtatgttgttgattctggactagccaaggagagc
agatttgtgcccagtagtggtctcaatgtattgaaagttaattggatttcccaaagttct
gctaatcaacgtgctggccgggcaggtcgaacaggagcagggaagtgttacaggctttac
tctgaagctgacttcagtatgatggatgtgcatcaagaacctgagatcaggaaagttcat
cttggcactgctgttctaagaatacttgctttgggtgttaaagatgcacggaaatttgag
tttgttgatgccccaaatcccgaagcaatcagtatggctgtgaagaatcttgaacagttg
ggtgctgtcaaacatagacttaattgctttgagctgactgatactggacgctacctggtc
aaattggggattgagccaaggcttgggaaaattatgcttgattgctttgatgttggtttg
aggaaggaaggtgtagttctagctgctgttatggcaaattctagcagcatattttgtaga
gtgggcaccgatgaggagaaacataaagctgaccttcagaaggtccggttgtgtcaccga
gatggagatcttttcactctacttgctgtttataagaaatgggaagatgggcatgacaac
agaaatatgtggtgctggcagaacagcatcaatgccaagaccatgaggagatgccaggaa
accatatcagaacttgaaaactgtctaaagcatgaactgaacatcattatcccaagttat
tggcgttggaatcccgaggctcccactgtgcatgataaggatctaaagagaattatccta
tcatcacttacaggtaatcttgccatgtttttaggacatgaaaggtttggttaccaggtg
atttcgacaggtcaggttgtgaaccttcatccctcatcctcattgctcaattatggcatc
aagccagagtgggttgtgtttacagaaattttgtcagtcccgaatcaatatttggtatgt
gtaaccgctgttgatcatgatgccttgtatacaattcacccggtgtctttcattcagcat
ctggaggaacaaaaattgcagataaaagtgattagtgggctcggtactaacttactgaga
aggttttgtggcaaatatggccaaaatcagcaaaagatcatctcgcgtctcaaggaagat
tgcagggatgaccgaataactgttgaaattaactttcaaaataatgaagttgtgttattt
gctacggaacagaatatggaaaaagtcttttgcactgtcaacagtgctttgaaatgtgaa
ggtaagatattgaggaacgagtgcctagagagaaatttatttcctgggaggcctggcagt
tctcctattgcactatttggttcaggtgctgaaatcaagcatttggaacttggggggagg
tatctaacagtagaggttttgcatcaaaatgctcatgatatcgatgacaaggagcttatt
ttcttggtggatagtattgtctctggcgtcgctaattttcataaatccactggaagtttt
cggatagcctcagatggaattaaatgggggaagtttacatttctgaaacctgaaaatgct
gaagatgctgtttcaaaactcaatggcatagaatttaatggttcctcattaaaattagtt
cctgtatgtacttccgataatcgaggattaccatttcctgcggtgagagctaaattatgt
tggccacgtagatacagcagtggacgtgcacttgtaacatgtgccagcggggaagctgaa
tttgttgtaaatgactgctttgccctaggaattggtggaaggtatattaagtgcagggtt
agtactaagtatgagaattgtgtttttgctgaaggaattccaatgcatgtcactgagcca
gaactatatgatgcttttcgtagcacaacagcaaggagaatccttaatatccgtttgctc
agggtcaagggaaatgccatagctagcccctctgtttctacatgtgaagaagaactggtc
agagaaatttctccattcatgccaaataagagttttcctggacagaattttcgtgttgag
gtgtttcctccggaggaaaatgattcactgacaagagcaactataacttttgatggaagc
cttcatcgagaggctgcaagagcactggaccatcttgaagggcactttcttccttgttgt
caaccttggcagataatacagtgcaatcatgtgttccatagcactctgtcctgtccggta
cgtgtttacaatgttatcagccaggaagttgcttctctgcttgagagtttccaaagccaa
aaaggtgtatcttacaattttgaaaagaccgagaatggcatttttcgattaaagctcaca
gcaaatgccacgaaaacaatagcagatttgagaaggccacttgagattttgatgaaaggc
aaaaccataaaccaccctgatctgacattaagtgcagttcaactgctcttgtcccgtgat
ggtgtagcacatttgaaatcaattgaacaagaaactggtacttacattatgtatgacagg
caaagtctaaatattaaagtctttggacaccaagaacagatggctgcagcggaggtgaaa
ttggttcatgcacttcgacaactacttgagaagaagcctcttgaaatttgtcttcgtggc
cacaacctccctccagacttgatgaagaaaacggtagaaaactttggagttgatctggaa
gggtttaacaaagagatgcctgagataaaggttgagttacaccaacaccgccatttactt
aaagtttggggcagtaaggaggataagcgaagggtggaaaggatgatctttgagttagcc
tcctttaaacacagttccctggttcaacttgcatcagagaatgttggaggcaaagaagat
aatcaaagggtggattacagtgagccgtcagaggatgcatgccctatttgcttgtgtgag
atagaagatccttttaggcttgaatcatgtgggcacatgttttgtctggcttgtctgatg
gatcagtgtgaatctgcgatgaaatcacatgatgggttccctatttgttgcctgaaaact
gggtgcaaggagcctctccttgttgtagacctgaagcatctcttgtcaaatgagaagctg
gaggacctattcagagcttccttgagggcatttgttgcatctagagcaggaatgtaccgc
ttctgcccaacacctgattgccaatccatctaccaagtggcagctccagatgcagaaacc
aaacctttttcttgtggggcttgctatgtggagatatgcaccaagtgtcatttcgagtat
catcctttcatatcatgtgaggcttacaaagaatacaaggaagacccagactcgacgctg
cttgaatggcgcaaagggaaggcgaatgtgaagagctgcccttcctgtggatacacaatt
gagaaagctgatggctgcaaccatgttgagtgcaggtgcggcagccacatttgctgggtt
tgtttggagaacttcaggagcagcgaggagtgttatggccatctcaggtctgtgcaccag
tcctttgtggacattgtgtaa

DBGET integrated database retrieval system