KEGG   Aegilops tauschii (wheat D): 109740076Help
Entry
109740076         CDS       T04345                                 

Gene name
LOC109740076
Definition
(RefSeq) wall-associated receptor kinase 2-like
Organism
ats  Aegilops tauschii (wheat D)
Brite
Enzymes [BR:ats01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109740076 (LOC109740076)
Protein kinases [BR:ats01001]
 Serine/threonine kinases: TKL group
  IRAK family
   109740076 (LOC109740076)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr GUB_WAK_bind EGF_CA APH cEGF EGF EGF_3
Motif
Other DBs
NCBI-ProteinID: XP_020154697
Position
Unknown
AA seq 728 aa AA seqDB search
MKMQMLLPLVTTTVLLSIPAWQPLAAAPACQRKCGGVDIPYPFGIGRGCFLDTGDRTFEV
TCRKATASDDARPFVDGFEVLGIDPGRGKIRIRSPVSSWCYDGARRSMGAPDAWSFNSTA
LRVSDADNKLAVVGCSALAYIGSQDGAVENRYVVGCHAECASAASLSDGPCNGTGCCLTP
VPPGISSFDVAFDDAYNNSAVAGFSRCSYAVLVEAAAFEFRATYVTTGALGDAGGVQLPA
VLDWAVGNQTCRDALRKKTGAYACASANSECIDAKNGPGYLCNCSKGYQGNPYVIHGCQD
INECEEKASYPCAIRDSCINTIGGYKCPCPAQKRGYSDGTCEADKSITKLQVAIGFSIGV
VMLALGMSCTYAIQEKRRVAVVKTRHFRQHGGQLLFEEMKKSNKQGMSFTLFTKQELQEA
TGNFDERHVLGKGGNGTVYRGTLQDGTAVAIKRCRIAGEDERQQREFGMETLILSQINHK
NIVKLYGCCLEVEVPMLVYQFIPNGTLYQLIHGGAAVVPFAVRLRIAHETAEALAYLHSM
ASPPIIHGDVKSPNILLDENYGAKVSDFGASSLAPAPTDEAHLVTFVQGTCGYLDPEYMQ
TCRLTEKSDVYSFGVVLLELLTSRKALNLAAPDDEKSVVASFLTAARDGRLDGLLDARIK
SEVRAETLEQVAKLAKLCLEMSGERRPSMREVAEELDGIRKASSQNPCLLGEGEEALSGY
SVVDMCDW
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgcagatgctgcttccactagttaccaccacggtgctcctctcgatcccagca
tggcagccgttggccgcggcgccggcgtgccagcggaagtgcggcggggtggacatcccg
taccccttcggcatcggccgcggctgcttcctggacacgggggacaggaccttcgaggtc
acctgccgcaaagccaccgcttccgacgacgcccggcccttcgtcgacggcttcgaggtg
ctcggcattgacccgggccgcggcaagatacgcatccgcagcccggtcagctcgtggtgc
tacgacggcgcgaggcggtccatgggcgcgccggacgcgtggtccttcaactcgacagcg
ctccgcgtctcggacgcggacaacaagctcgccgtcgtcgggtgcagcgcgctcgcctac
atcgggtcgcaggacggcgccgtcgagaaccggtacgtggtggggtgccacgccgagtgc
gcgagcgcggcgtcgctgtccgacggcccgtgcaacggcacgggatgctgcctcacgccg
gtgcccccggggatcagctccttcgacgtggccttcgacgacgcctacaacaactccgct
gtcgccggtttcagccggtgcagctacgccgtgctggtggaggcggcggcgttcgagttc
cgggcgacctacgtcaccaccggcgcgctcggggacgcgggcggcgttcagctgccggcg
gtgctggactgggcggtgggcaaccagacgtgccgggatgcgttgcggaagaagacgggc
gcgtacgcctgcgcaagtgccaacagcgagtgcatcgacgccaagaacggcccgggctac
ctctgtaactgctccaaagggtaccaaggaaacccttacgtcatccatggctgccaagat
attaacgagtgtgaggagaaggcgtcgtatccatgtgccattcgtgattcctgtatcaac
acgatcggagggtacaaatgcccatgccctgcacaaaagcgaggctattctgatggaaca
tgcgaagcggataaatccataactaaattgcaagtcgccataggttttagcatcggcgta
gttatgctggcactgggcatgagctgcacctacgccatccaagagaagcggcgagtcgcc
gtcgtcaagacacggcacttccggcagcacggcggccagctgctgttcgaggagatgaag
aagtccaacaaacagggaatgtccttcacgctgttcaccaagcaggagctgcaggaggcc
accggcaacttcgacgagcggcacgtgctgggcaagggcggcaacggcaccgtgtaccgt
ggcacgctccaggacggcacggcggtggcgatcaagcggtgcaggatcgccggcgaggac
gagcggcagcagcgggagttcggcatggagacgctcatcctctcccagatcaaccacaag
aacatcgtgaagctctacgggtgctgcctcgaggtggaggtgcccatgctcgtctaccag
ttcatccccaacggcaccctctaccagctcatccacggcggcgccgccgtcgtgccgttc
gcggtgcgtctgcggatcgcgcacgagacggccgaggcgctggcgtacctgcactcgatg
gcatcgccgccgatcatccacggcgacgtcaagtcccccaacatcctcctcgacgagaac
tacggcgccaaggtgtccgacttcggggcgtcgtcgctggcaccggcgccgacggacgag
gcgcacctggtgacgttcgtgcaggggacgtgcgggtacctggacccggagtacatgcag
acgtgccggctgacggagaagagcgacgtgtacagcttcggcgtggtgctcctggagctg
ctcacgtcgcggaaggcgctgaacctcgccgcccccgacgacgagaagagcgtcgtcgcg
agcttcctgacggcggcgagggacggcaggctggacggcctgctggacgcgcggatcaag
agcgaggtgagggcggagacgctggagcaggtggccaagctcgcgaagctgtgcctggag
atgtccggcgagagaaggccctccatgcgagaggtcgccgaggagcttgacgggatcagg
aaggcgtcgtcacagaacccatgcttactaggtgagggtgaagaagctctgtcaggctac
tctgttgtggatatgtgtgactggtga

DBGET integrated database retrieval system