KEGG   Aegilops tauschii (wheat D): 109741036Help
Entry
109741036         CDS       T04345                                 

Gene name
LOC109741036
Definition
(RefSeq) putative 1-phosphatidylinositol-3-phosphate 5-kinase FAB1C isoform X1
  KO
K00921  1-phosphatidylinositol-3-phosphate 5-kinase [EC:2.7.1.150]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00562  Inositol phosphate metabolism
ats01100  Metabolic pathways
ats04070  Phosphatidylinositol signaling system
ats04145  Phagosome
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109741036 (LOC109741036)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    109741036 (LOC109741036)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109741036 (LOC109741036)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ats04131]
    109741036 (LOC109741036)
Enzymes [BR:ats01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.150  1-phosphatidylinositol-3-phosphate 5-kinase
     109741036 (LOC109741036)
Membrane trafficking [BR:ats04131]
 Endocytosis
  Macropinocytosis
   Kinases
    109741036 (LOC109741036)
 Endosome - Golgi transport
  Others
   Others
    109741036 (LOC109741036)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIP5K Cpn60_TCP1
Motif
Other DBs
NCBI-ProteinID: XP_020155701
Position
Unknown
AA seq 1623 aa AA seqDB search
MGVVEFSVLGAVQKFRSLITGSTPAADEEARQASAPPSPATPPRSGGVSPVDSPPPAARS
GGRRAIALRRQISSPQPLRCYPVRRADGEENDGPGKFFTPGNDCLNDLSDTDSVSELNRS
MTLSPLESPTWMVWQNGGTRTSRTNGRFSLDSLEHGTKTIAESSGESDTNKHQVDFDANI
WRPPPPEDEGDDAESRVFGFDDDDDDDDGVEESSNLLALGCFSTNKTVGADMITDIAHTE
GLRNAVLGHFRALVAQLLNGEGISVGNDDGCISWLEIVSSLSWQAASYVRPNTKKGGSMD
PTDYVKVKCIASGDPTDSNLVRGVVCSKNLKHKRMMSEHRNAKLLILGGALEYQRVTNKL
ASIDTILEQEKEHLRTIVRNIESLQPNVLLVEKSVSSYAQELLAKEISLVLNVKRPLLER
ISRCTGAQIGSSIENIASARLGQCEMFKVQKFLEFPSGKQTNRRSTKTLMFFEGCPRRLG
CTVLLRGPCREELKKVKRTVQLAVFAAYHLSLETSFFADEGATLPKGPSRPVIELPDIRG
DTDCFAGSAGVGMPHKLKQIQGDDSRMFEEISVSPRSLCLNEEGESVVFEHRESGSPVEH
RESGSPVEHRESGSPVDDYLPHAIGSCEESKISPYFLDLDPRTSGIVMHFHDSALFFIAN
NNRQDVVPGKKCQEVDHWNHKRHHDCPAGDCNDQNEFSGEFFGTNDNHQSILVSLSSTCI
PKSLVCERPQLFRIKFYGSFDKPLGRYLRQDLFDQAYCCPSCKEPSESHVRCYIHQHGSL
TIRVRRLLSQKLPGERDGRIWMWHRCLKCEPKNGVPPATRRVIMSDAAWGLSFGKFLELS
FSNRSTANRIASCGHSLQRDCLRFYGYGNMVAFFRYSPVDILSVTLPPSVLCFNCRSPQD
WTKTVAVEIYGKMKSLHWEISDFLHRTEKNIPSEDDPVKTGIHRQIIEMKDLLKMERNEC
EILLLPVIRDSNHHVQASIDILELNRLRRGLILDAYLWDRRLCHIDSLIETNGCVSKNNP
ATEFLLDIRLKEWKTDLLEADTNIGKPTCLLQSPGSPRKSLLSREVCFSDDEYSMSGKKL
QIDLVDHPGDDTEDLDKVFSKFNGEKEWPSTRAAIGMEPVERLPSLASIFSDNIDLAWTG
SSELQYDLPQDFTKIDENGSLNLLDNPGYKNAPVRIHSFDSTVASRQRERTGLAPTSLHL
SSFRSAEYFGGLTSITKDPMPNIRRACSQRSPGAIEKLNVILTRSPTHISSASHMVDDGA
RLLLPQIGNEDVVVAVYDDEPTSIVAYAMTSNEYVQKVTRKLNSTSSFSHLPNATELNHG
LEQSLPSQENNLDSEGTHFKFSFDDETPLPADNAKFSVICYFAKHFAALRDKCCPKDIDY
IRSLSRCKRWSAQGGKSNVYFARTLDERFIIKQVTKTELDSFVEFAPQYFKYLMESLASG
SPTCLAKIVGLYQVNVKGLKTGREVKMDLMVMENLFFEKKIPRVYDLKGSLRSRYTSGDS
KVLLDSNLIEALHTKPIFLGSRAKRRLERAVWNDTSFLASADVMDYSLLVGIDEEKKELV
IGIIDYLRQYTWDKQLETWVKASGILGGPKNEAPTIISPMQYKKRFRKAMSKYFLTVPDQ
WTS
NT seq 4872 nt NT seq  +upstreamnt  +downstreamnt
atgggagtggtggagttctcggtgctgggggcggttcagaagtttcgatccctcatcacc
ggctccacgcccgccgccgacgaagaagcccgccaggcgagcgcaccaccgtcgcccgcg
acgccgccgcgcagcgggggcgtatctccggtggattcgccgccccccgcagcgagatcc
ggaggcaggcgtgccatcgccctccgccgccagatctcgtcgccacagcctctccgctgc
taccctgtcaggcgagcagatggcgaggaaaacgacgggcctgggaagtttttcacccca
gggaacgactgcttaaatgacctctcagacactgactctgttagcgagctcaaccggtct
atgaccctaagccccttggagagcccgacctggatggtctggcagaatggcggcacacga
acttccaggacaaacggccgtttcagcctggattctcttgaacatggtactaagaccatt
gctgaaagtagtggggaaagcgacacaaataaacatcaagttgattttgatgccaatatt
tggcgcccaccaccgccggaagatgagggtgatgatgctgagtcgagagtatttggattc
gacgacgacgatgatgatgatgatggggttgaggagtcaagcaatcttcttgcccttggc
tgctttagcaccaacaaaacagttggtgctgacatgatcacggatatagcccatacagag
ggtctgaggaatgctgtactaggtcattttcgtgctcttgtggctcagttactgaatgga
gaaggtatcagtgtcggaaacgatgacggatgcataagttggcttgagatagtgtcgtcc
ttatcctggcaagctgctagttatgtgagaccaaatacaaagaaaggtggcagcatggat
cctactgattatgtcaaagtcaaatgtatagcatctggggatccgactgatagcaatctt
gttaggggagttgtttgttccaaaaacttaaaacacaaacgcatgatgtctgagcatagg
aatgcgaagttgctcattttaggaggagcacttgagtaccaaagggtcactaacaaatta
gcatcgatagacactattcttgaacaggagaaagagcacctgagaacgattgtcagaaat
atagagtctttgcaaccaaatgtgctgctagttgagaaaagtgtctcatcgtatgcccag
gagctcttggcaaaagaaatttcattagttctaaatgttaagaggccactcttggagagg
atatcaagatgcacaggagcacaaattggctcatcaattgaaaatattgcttcagcaagg
ctaggccagtgtgaaatgtttaaggtgcagaaatttctggaatttccatcaggaaagcag
acaaacaggagatcaactaaaacattgatgttctttgaaggctgcccaaggcgtttgggc
tgcacggtcttactgagagggccctgtcgagaggaactaaaaaaagttaagcgtacagta
caacttgcagtctttgccgcctatcacctctctcttgaaacatcattcttcgctgacgaa
ggcgcaactcttcctaaaggtccttcaaggcccgtaatagagttgccagatattcgaggt
gacacagattgttttgctggatctgctggagttggcatgcctcataaactcaaacaaata
caaggcgatgattcacgaatgtttgaggaaatttctgtatcacctagatcattatgtttg
aatgaggaaggtgaaagtgtcgtctttgagcacagggaatctggatctcctgttgagcac
agggaatctggatctcctgttgagcacagggaatctggatctcctgttgatgattactta
ccccatgcaattggttcgtgcgaagagagtaaaatttctccatatttccttgatcttgat
ccaagaacttcaggtattgtgatgcattttcatgactctgctttgtttttcattgcaaac
aataaccgtcaagatgtggtaccagggaagaaatgtcaagaagtagaccattggaatcat
aaacgacatcatgactgtcctgccggagactgtaatgaccagaatgaattttctggtgaa
ttctttggtaccaatgacaaccatcagagcatcttagtttccctatcaagcacttgcatt
cccaaaagcttggtatgtgagcgtccacagctcttccgcattaagttttacggtagcttt
gataagccacttgggagatacctccggcaagacttatttgatcaggcatattgttgtcca
tcatgtaaagaaccatcagaatcacatgtaaggtgctatattcatcagcacggaagctta
acaattcgtgttaggcggcttctgtctcagaagttgccaggggagcgtgatgggaggata
tggatgtggcatagatgcctcaagtgcgaacctaagaatggtgtaccacctgctacgcgg
agggtaattatgtcagatgctgcttggggcctgtcatttgggaaattcctggagctaagc
ttttcaaaccgctctactgctaaccgaattgcaagctgtgggcattctctccagagggac
tgtcttcgtttctacggatatgggaacatggtggccttcttccgatattctcctgttgat
attctatcagttaccctccccccctccgtattgtgtttcaactgtcgcagtccacaagac
tggaccaaaacggtggcagttgagatatatggcaaaatgaaatccttacactgggagata
tctgattttctccatcgcactgaaaagaatattccaagtgaggatgatccggtcaagaca
ggtattcataggcagataattgagatgaaggatttgcttaaaatggaaagaaacgaatgc
gagattttgctcttacctgttatcagagatagtaatcaccacgtgcaggcatcaattgat
attctggagctcaaccgcttgaggcgtggccttattcttgatgcttacctttgggatcgg
aggctatgtcacatagattcacttattgaaacaaatggttgtgtttcaaagaacaatcct
gctaccgaatttctcttggacatcagactgaaggagtggaaaacagatttgcttgaggcg
gacacaaatattggaaaacccacttgtttgttgcagtcacctggaagtccaagaaaatct
ttgttatccagagaggtctgcttcagtgatgacgagtacagtatgtctgggaaaaaattg
cagattgatctggttgatcatcctggtgatgatacagaagatcttgacaaggtcttcagc
aaattcaatggagagaaagaatggccatccactagagctgctattggtatggaacctgtt
gagaggttaccctcacttgcgtctattttttctgataacattgatttagcatggactgga
tccagtgagttacagtatgatcttccacaagatttcaccaaaatcgatgaaaatggatcc
cttaatttgttggataacccaggttacaagaatgcccctgttagaattcactcatttgat
tctacagtagcatcccgtcagcgagaacgcactggattagctcctacttcattgcatcta
tcgtcattcagatctgctgagtacttcgggggtttgacaagcatcacaaaagatccaatg
ccaaatataaggagggcttgttctcaaaggtcacctggggccatagagaaattaaatgtt
attctaactcgttcacccacacatatctcatccgcttcacatatggttgatgatggggca
cggctgctgctgccccagattggcaatgaagatgttgttgttgcagtctatgatgatgaa
cccaccagtattgttgcatatgccatgacttcaaatgaatatgtgcagaaagtcacacga
aaactaaattcaacttcgagtttttcacatcttccaaatgccaccgagttaaaccatgga
cttgaacagtcattgccctcacaagaaaacaatctggattctgagggaactcattttaag
ttttctttcgacgacgaaacccctcttcctgcagataatgcgaagttctctgtgatttgt
tattttgcaaagcattttgctgcgcttagagataaatgctgtccaaaagatattgattac
atccgttcactaagtcgctgcaagagatggtctgcacaaggtggaaaaagcaatgtttac
tttgcaaggacactggatgagaggttcataatcaaacaagtcaccaagacagagctggac
tcttttgtggaatttgctcctcagtacttcaagtatttgatggaatccttggcctctggt
agcccaacttgcctggcaaaaatagtaggattatatcaggttaatgtcaagggcttgaaa
actggaagggaagtgaagatggatctaatggtgatggagaatcttttctttgaaaaaaag
atacctagggtgtatgatctgaagggttcattacgctctcgctacacatccggtgatagc
aaagtcttgttagattcaaacctcatagaggcactgcatacaaagcctatatttttaggg
agccgagcaaagcgaagattggaaagagctgtctggaatgatacttcgtttcttgcgtcg
gcggatgtcatggattactcgcttcttgttggaatcgacgaggagaagaaagaactcgtc
attggcatcatcgattacttgcgccaatacacctgggacaaacagcttgagacttgggtg
aaggcctctggcatcctgggaggccccaagaacgaagcccccaccattatatccccgatg
cagtacaagaagaggttcaggaaggccatgtccaagtacttcctcaccgtccctgatcaa
tggacctcttaa

DBGET integrated database retrieval system