KEGG   Aegilops tauschii (wheat D): 109741381Help
Entry
109741381         CDS       T04345                                 

Gene name
LOC109741381
Definition
(RefSeq) long chain acyl-CoA synthetase 6, peroxisomal-like isoform X1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00061  Fatty acid biosynthesis
ats00071  Fatty acid degradation
ats01100  Metabolic pathways
ats01212  Fatty acid metabolism
ats04146  Peroxisome
Module
ats_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    109741381 (LOC109741381)
   00071 Fatty acid degradation
    109741381 (LOC109741381)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109741381 (LOC109741381)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ats01004]
    109741381 (LOC109741381)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ats04147]
    109741381 (LOC109741381)
Enzymes [BR:ats01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     109741381 (LOC109741381)
Lipid biosynthesis proteins [BR:ats01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   109741381 (LOC109741381)
Exosome [BR:ats04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   109741381 (LOC109741381)
  Exosomal proteins of breast cancer cells
   109741381 (LOC109741381)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C DUF3572 Apo-VLDL-II
Motif
Other DBs
NCBI-ProteinID: XP_020156050
Position
Unknown
AA seq 702 aa AA seqDB search
MAREEEGPAMMDAAERRLRVVSAHLEPQAGATAGLASNPTAGEYAHVQGYSVVLPEKLQT
GKWNVYRSAESPLRLINRFPATPDIGTLHDNFVYAVETFTDCRYLGTRVCADGAVGDYKW
MTYGEASTSRTAIGSGLIYHGISEGARIGLYFINRPEWIIIDHACAAYSYVSVPLYDTLG
PDAVQFIVNHATVETIFCVPQTLSTLLSFLTQMPCVRLIVVVGGDNANTPSTTAAAGVEI
ITYSRLHSQGKMSSQTYRPPKPEDVATICYTSGTTGTPKGAVLSHENLIANVAGSSLGVK
FYPSDVYISYLPLAHIYERANQIALLHYGVAIGFYQGDNLKLMDDLAALRPTVFASVPRL
YNRIYSAITNAVKDSGGLKERLFRTAYNAKRQALMNGRNPSPMWDKLVFNKIKARLGGRV
RLMTSGASPLSADVMEFLRICFGGEVLEGYGMTETSCVITTMDIGDKLIGHVGSPNPSCE
VKLVDVPEMNYTCEDQPYPRGEICVRGPTIFRGYYKDEVQTRDVIDNDRWLHTGDIGLWL
PGGRLKIIDRKKNIFKLAQGEYIAPEKIENVYAKCKFIAQCFIYGDSFNSFLVAIVAVEP
DVLKAWAASQGIQSEDLRQLCADPRAKAAVLADMDSIGKEAQLRGFEFAKAVTLVAEPFT
VENGLLTPTFKVKRPQAKAYFVKELADMYAQLRDAESARQKL
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgggaggaggaaggacccgcaatgatggacgccgcggagcgacgcctccgcgtg
gtctccgcgcacctcgagccgcaggccggcgccaccgctggcctcgcctctaaccccacc
gccggcgagtacgcccacgtgcagggctacagcgttgttcttcctgaaaagttgcaaact
ggaaagtggaacgtgtaccgatctgcagagtcacctctgcgtttaattaacagatttcct
gctactccagacattggaacactgcatgataattttgtgtatgcagtcgagacttttaca
gattgtaggtatctgggtacaagagtgtgcgctgatggagcagtcggagactacaaatgg
atgacgtatggagaagctagtacgagcagaactgcaataggttctggtcttatttatcat
ggaatatctgaaggtgcacgcattggtctgtattttataaacagacctgagtggatcata
attgatcatgcttgtgctgcatattcatatgtatctgtaccactttatgatactcttggt
ccagatgcagttcagttcattgtgaaccatgcaacagtagaaactattttctgtgtgcct
caaacactaagcactctgctaagcttcctaactcaaatgccatgtgtccgccttatagtg
gtagttggtggagacaatgcaaatacgccatctacaacagcagctgctggagtggaaatc
ataacttactccaggctacacagccagggaaagatgagttctcaaacttaccgtcctcca
aaacctgaagatgttgccactatctgctacacgagtggcactactggcacaccaaaggga
gctgttctttctcatgagaacttaatcgcgaatgttgcaggatcaagcttgggcgttaag
ttttacccctccgacgtgtatatctcatacctacctttagctcacatctatgagagagct
aaccaaattgcactgcttcactatggagttgccattggattttaccaaggggataatttg
aagctgatggatgatttggctgctttgagaccaaccgtattcgcaagtgttccccggcta
tataacagaatttattctgcaatcacaaatgctgtgaaggattctggtgggctaaaagaa
agactattccgtaccgcgtacaatgccaagaggcaagctcttatgaatggacgaaatcct
tccccaatgtgggataagttggtatttaacaaaataaaagctaggcttggtggacgtgtg
aggcttatgacttcaggcgcttctccattgtcagcagatgtaatggaattcctaagaata
tgctttggtggtgaggttcttgaaggctatggaatgacagagacatcttgtgtcatcact
acaatggatattggtgacaaattaattggtcatgttggatcaccaaatccttcttgtgag
gttaaacttgtggatgtcccagaaatgaattacacttgtgaggatcaaccatatcctcgt
ggagaaatatgtgttagaggacctacaatattccgcggttactataaagacgaagtccaa
acaagggatgtcattgacaatgatcgctggttgcacactggagacataggtttgtggctg
cctggagggcgtctaaaaattatagataggaaaaagaacattttcaagttggctcaagga
gaatacatagctccagagaagattgagaatgtgtacgctaagtgcaagttcattgctcaa
tgctttatatatggtgatagtttcaactcttttctagttgccattgtagcagttgaacca
gatgttttgaaggcttgggccgcatctcaaggaatacaaagtgaggatttaagacagctt
tgtgctgacccgagagcaaaagctgctgtcttggctgacatggattctattggaaaggaa
gcacagctaagaggttttgaatttgccaaagctgttactcttgttgctgaacctttcaca
gtagaaaatggtctcctcaccccaacgttcaaggtcaaaagaccgcaagctaaggcctac
ttcgtgaaagaactcgcagatatgtatgcacaactgcgtgacgccgaatcagctaggcag
aagttgtaa

DBGET integrated database retrieval system