KEGG   Aegilops tauschii (wheat D): 109742704Help
Entry
109742704         CDS       T04345                                 

Gene name
LOC109742704
Definition
(RefSeq) sirohydrochlorin ferrochelatase, chloroplastic-like
  KO
K03794  sirohydrochlorin ferrochelatase [EC:4.99.1.4]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00860  Porphyrin and chlorophyll metabolism
ats01100  Metabolic pathways
ats01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    109742704 (LOC109742704)
Enzymes [BR:ats01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     109742704 (LOC109742704)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CbiX CbiK
Motif
Other DBs
NCBI-ProteinID: XP_020157394
Position
Unknown
AA seq 188 aa AA seqDB search
MSMHPMSLSLQPFTANSINKYSLRSTSANYDRGFIKLVPIGRSSGHWATNFRPNSVSRPE
TSVGHDCVVGENDGVIIVDHGSRRQESNLMLHDFFSMFKARTCYKIVGPAHMELAEPTIK
EALGKCVQQGASRVIVSPYFLSPGRHWKQDIPSLASEASKEHSSVPYIITAPLGLHELMV
DRNVEKEV
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgcaccctatgtcgctctccttacaacccttcactgcaaattcaataaacaaa
tattctttaaggagcactagtgcaaattatgaccgtggttttataaagttggtgccaatt
ggaagaagtagtggacattgggccacaaatttcagaccaaattctgtgtctaggcctgaa
acttctgtaggacatgattgtgtagtgggagagaatgatggtgtgatcatagttgatcac
ggatcacgtcgacaagaatctaatctcatgctacatgatttttttagcatgttcaaggcc
aggacttgctacaagattgttgggcctgctcacatggagctggctgagcctactattaag
gaagcacttggaaaatgtgtgcagcagggagcatctcgcgttattgtcagtccatatttc
ctttcccctgggcgacactggaagcaagatatcccttctttagcatcagaagcctctaaa
gagcactcaagcgtaccctacatcatcacggctcctcttggattacatgagcttatggtg
gatagaaatgttgagaaggaagtgtag

DBGET integrated database retrieval system