KEGG   Aegilops tauschii (wheat D): 109743538Help
Entry
109743538         CDS       T04345                                 

Gene name
LOC109743538
Definition
(RefSeq) alpha-glucan phosphorylase, H isozyme-like
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00500  Starch and sucrose metabolism
ats01100  Metabolic pathways
ats01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    109743538 (LOC109743538)
Enzymes [BR:ats01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     109743538 (LOC109743538)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphorylase
Motif
Other DBs
NCBI-ProteinID: XP_020158230
Position
Unknown
AA seq 832 aa AA seqDB search
MSAADKVKPAASPASEDPSAIAGNISYHAQYSPHFSPLAFGPEQAFYATAESVRDHLLQR
WNDTYLHFHKTDPKQTYYLSMEYLQGRALTNAVGNLAITGAYADALKKFGYELEAIAGEE
RDAALGNGGLGRLASCFLDSMATLNLPSWGYGLRYRYGLFKQRIAKEGQEEIAEDWLDKF
SPWEIVRHDVVYPIRFFGHVEISPDGKRKWAGGEVLNALAYDVPIPGYKTKNAISLRLWD
ATATAEDFNLFQFNDGQYESAAQLHSRAQQICAVLYPGDATEEGKLLRLKQQYFLCSASL
QDIIFRFKERKSDRASGKWSEFPSKVAVQMNDTHPTLAIPELMRLLMDVEGLGWDEAWAV
TNKTVAYTNHTVLPEALEKWSQAVMRKLLPRHMEIIEEIDKRFREMVISTRKDMEGKIES
MRVLDNNPEKPVVRMANLCVVAGHTVNGVAELHSNILKQELFADYVSIWPNKFQNKTNGI
TPRRWLRFCNPELSEIVTKWLKTDQWTSNLDLLTGLRKFADDEKLHAEWAAAKLASKKRL
AKHVLDVTGVTIDPNSLFDIQIKRIHEYKRQLLNILGAVYRYKKLKEMSAEERKKVTPRT
VMVGGKAFATYTNAKRIVKLVNDVGAVVNNDADVNQYLKVVFIPNYNVSVAEVLIPGSEL
SQHISTAGMEASGTSNMKFSLNGCVIIGTLDGANVEIREEVGQDNFFLFGAKADQIAGLR
KERENGLFKPDPRFEEAKQFIRSGAFGTYDYTPLLDSLEGNTGFGRGDYFLVGYDFPSYI
DAQARVDEAYKDKKKWIKMSILNTAGSGKFSSDRTIDQYAKEIWGISACPVP
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggcggacaaggtgaagccggcggccagcccggcgtcggaggatccctccgcc
atcgccggcaacatctcctaccacgcgcagtacagcccccacttctcgccgctcgcattc
ggccccgagcaggccttctacgccaccgccgagagcgtccgcgaccacctcctccagaga
tggaacgacacgtacctgcatttccacaagacggatcccaagcagacctactacctgtcc
atggagtacctacagggccgcgcgctcaccaacgccgtcggcaacctcgccatcaccggc
gcctacgctgacgccctgaagaagttcggctacgagctcgaggccatcgctggagaggag
agagatgcggctctgggaaatggtggcctgggcaggcttgcatcttgctttttggattca
atggcaacactgaacttgccttcttggggctatggccttcgttaccgatatggcctgttc
aagcagcgcattgccaaggagggccaagaagaaatcgctgaagactggcttgataagttt
agcccatgggagattgtcaggcatgacgttgtatacccaatcagatttttcggccatgtc
gagatttcgcccgatggaaagcggaaatgggccggtggagaagttctgaacgctttagcc
tatgatgtgccaattcctgggtacaagacaaaaaatgcaatcagtcttcgcctttgggat
gcaacagctactgctgaggatttcaacttatttcagttcaatgatggccagtatgagtca
gctgctcaacttcactcgagggcgcagcagatatgtgctgttctctatcctggtgatgct
acagaagaaggaaagcttctgagattaaagcagcagtatttcctttgcagcgcatcactt
caggatattattttcagatttaaggaaaggaaatctgacagagcttcagggaagtggagc
gagttcccttccaaagttgctgttcaaatgaatgacactcacccaactcttgccatccct
gagctaatgaggttgcttatggacgtggagggacttggttgggacgaagcctgggctgtc
acaaataagacggttgcttacaccaatcacacagttcttcctgaagctcttgagaaatgg
tcacaggctgtaatgaggaaattgcttccacgtcacatggaaatcattgaggaaattgac
aagcggtttagggaaatggtaatctccacccgcaaggatatggagggaaagatcgaatcg
atgagggttttagataacaatcccgagaagccagtagtgcggatggcgaatttgtgtgtc
gtggctgggcatacggtgaatggagtggccgagttgcacagcaacatcttgaaacaagag
ctgtttgcagattatgtctctatttggcctaacaaattccagaacaaaactaatggaatt
acaccccgcagatggctccgtttttgcaaccctgagctgagtgaaatagtcacaaaatgg
ctaaaaacagatcagtggacaagcaaccttgatcttctcaccggtcttcggaaattcgca
gatgatgaaaaactacatgctgagtgggcagcagccaagctggccagcaaaaagcgctta
gccaagcatgtgttggatgtgactggtgttacaattgatccaaatagccttttcgatata
caaattaaacgcatccacgaatacaagagacagctgttgaacattttgggagctgtgtac
agatacaagaagttaaaggaaatgagcgcagaagagaggaagaaggttacaccacgcact
gtcatggtaggagggaaagcatttgcaacatacaccaatgctaaaagaatagtgaaattg
gtaaatgatgttggtgctgtggtgaacaatgatgctgacgtcaaccaatatctgaaggtg
gtgttcattccaaactacaacgtatcagtggctgaagtgctcattcctggcagtgaactg
tcacagcacatcagtactgcaggcatggaagcaagtggaacaagtaacatgaagttctct
ctgaatggctgtgttatcattggaactctcgatggagccaatgttgaaatcagagaagaa
gtagggcaagacaacttcttccttttcggtgccaaagcagatcagattgctggtctgagg
aaggaaagggaaaatggcttgttcaagccagacccacgctttgaagaagccaagcagttt
atcaggagtggtgctttcggcacttacgactacactcctctcttggattcccttgaaggg
aacactggatttgggcgtggtgactacttccttgttggctatgacttcccaagctacatt
gatgcacaggcccgggttgatgaagcctacaaggacaagaagaaatggatcaagatgtct
atcttgaacacggctggcagcggcaaattcagcagcgaccgcaccatcgaccagtacgcc
aaggagatctggggcatttcggcctgccctgttccatga

KEGG   Aegilops tauschii (wheat D): 109758695Help
Entry
109758695         CDS       T04345                                 

Gene name
LOC109758695
Definition
(RefSeq) alpha-1,4 glucan phosphorylase L isozyme, chloroplastic/amyloplastic
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00500  Starch and sucrose metabolism
ats01100  Metabolic pathways
ats01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    109758695 (LOC109758695)
Enzymes [BR:ats01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     109758695 (LOC109758695)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphorylase DUF3654
Motif
Other DBs
NCBI-ProteinID: XP_020173151
Position
Unknown
AA seq 968 aa AA seqDB search
MATASPPLATAFRPLAAGSGTGGGGAHAAGWVAPRRGRRGFVVRSVASDREVRGPASTEE
ELSAVLTSIDSSAIASNIQHHADFTPLFSPEHSSPLKAYHATAKSVFDSLIINWNATYDY
YNKVNAKQAYYLSMEFLQGRALTNAIGNLELTGQYAEALKQLGHNLEDVASQEPDPALGN
GGLGRLASCFLDSMATLNYPAWGYGLRYRYGLFKQIITKDGQEEVAENWLEMGNPWEIVR
NDVSYPVKFYGKVVEGTDGRKHWIGGENIKAVAHDVPIPGYKTKTTNNLRLWSTTVPSQN
FDLGAFNAGDHAKANEAHLNAEKICHVLYPGDESSEGKILRLKQQYTLCSASLQDIISRF
ESRAGDSLNWEDFPSKVAVQMNDTHPTLCIPELMRILMDIKGLSWNEAWSITERTVAYTN
HTVLPEALEKWSLDIMQKLLPRHVEIIETIDEELMNNIVSKYGTADISLLKQKLKDMRIL
DNVDLPASVAKLFVKTKMKKGKLLVESLESIAEADEKTEPEEEENILSETTEKKGESDSE
EAPDAEKEDPEYELDPFAKYDPQLPRVVRMANLCVVGGHSVNGVAEIHSEIVKQDVFNSF
YEMWPTKFQNKTNGVTPRRWIRFCNPELSAIISKWIGSDDWILNTDKLAGLKKFADDEDL
QSEWRTAKRNNKMKVVSLIRDKTGYVVSPDAMFDVQVKRIHEYKRQLLNILGIVYRYKKM
KEMSAKDRIKSFVPRVCIFGGKAFATYVQAKRIVKFITDVAATVNYDPDIGDLLKVVFVP
DYNVSVAEKLIPASELSQHISTAGMEASGTSNMKFAMNGCILIGTLDGANVEIREEVGEE
NFFLFGAHAPEIAGLRQERAEGKFVPDPRFEEVKEYVRSGVFGTSNYDELMGSLEGNEGY
GRADYFLVGKDFPSYIECQEKVDEAYRDQKLWTRMSILNTAGSPKFSSDRTIHEYAKDIW
DISPVIMP
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgcctcgccgccgctcgccaccgccttccgcccgctcgccgccggcagcggc
accggaggaggaggagcgcacgccgcgggctgggtcgcgccgaggcgggggcgccggggg
ttcgtggtgcggagcgtggcgagcgatcgggaggtgcgggggccggcctcgaccgaggaa
gagctttcagccgtgctaacttccattgattcttccgccatcgcgtcaaatatccagcac
catgcagacttcacaccgttgttctcgccagagcactcttcacccctaaaggcttaccat
gcaactgctaaaagtgtttttgattctctgatcatcaattggaatgcaacatatgactat
tacaacaaagtgaatgcaaagcaagcttattacctgtccatggagtttttgcagggaaga
gctctcacaaatgctattggcaatctagagctaacaggacaatatgcagaagcgttaaaa
caacttggacataacctagaggatgttgctagtcaggaaccagatcctgcccttggcaat
ggtggtctaggccgtctagcgtcctgttttctggattctatggcaaccctaaattatcca
gcatggggatatggacttcggtacagatatggcctctttaagcaaatcataacaaaggat
ggccaggaggaggtagctgagaattggctagagatgggaaatccatgggagattgtaaga
aatgatgtctcttatcctgtgaaattctacggcaaagtggttgaagggactgatgggaga
aaacactggattggaggagagaatattaaggctgtggcacatgatgttcctattcctggc
tacaagactaaaactaccaataatcttcgtctttggtcaacaacagtaccatcacaaaat
tttgatctgggagctttcaatgctggggatcatgccaaggccaatgaagcacatctaaat
gctgaaaagatatgccacgtattgtatccaggggacgaatcatcagaggggaaaattctt
cgcttgaaacaacaatatacattatgctcggcctccctgcaggacattatttctcgtttt
gagtcgagggctggtgattctctcaactgggaggacttcccctctaaagttgcagttcag
atgaatgacactcatccaacactgtgcattcccgagttaatgagaatactgatggatata
aagggattgagctggaatgaggcttggagtatcacagaaagaaccgttgcatacactaac
cacacggtacttcctgaagccctggagaagtggagcttggacattatgcagaaacttcta
cctcgacatgttgagatcatagaaacaatagatgaggagctgatgaacaacatcgtctca
aaatatggaacggcagatatttcactgttaaaacagaagcttaaagatatgaggatctta
gacaacgttgatcttccagcctctgtggctaaactgtttgttaaaacaaaaatgaaaaag
gggaagttgcttgttgaatctttggagtctattgctgaagctgacgagaaaactgagcca
gaagaagaggaaaacattctatccgagacaacagagaagaagggcgagtctgactctgaa
gaagctcctgatgcagaaaaggaggatcctgagtatgagttagatccatttgcaaaatac
gatcctcagttacctagagttgttcgaatggcaaacctctgtgttgttggtggacattca
gttaatggtgtggctgagattcacagtgaaattgttaagcaagatgtgttcaatagcttt
tatgagatgtggcctactaagttccaaaacaaaacaaacggagtaactcccaggcgttgg
atccggttttgtaatcctgaattaagtgcaatcatttcaaaatggataggctctgatgac
tggattctgaacactgataaacttgcaggactgaagaagtttgctgatgatgaggatctg
caatcagaatggcgtactgctaaaaggaataacaagatgaaagtagtttcactgataaga
gataagactggatatgttgtcagcccagatgcgatgtttgatgtgcaggtgaaaagaata
catgaatataagcggcagctgctaaatatccttggtatcgtttaccggtacaagaagatg
aaagaaatgagtgcaaaagatagaataaagagctttgttccaagggtatgcatatttggt
gggaaagcttttgccacttatgtacaggcaaagaggattgtgaagtttatcacagatgtc
gcagctactgtaaattatgatcctgatattggagatttactgaaggttgtatttgtccca
gattataatgttagcgttgctgagaagctcattcctgccagtgaattgtctcagcatatc
agtaccgctggaatggaggctagtggaaccagcaacatgaagtttgcaatgaatggttgt
attcttattggaactttggatggtgcgaatgtggagatcagagaagaggttggagaggag
aactttttcctctttggtgcacatgcacctgaaatcgctggtttgaggcaagagagggct
gaaggaaagtttgtgcctgacccgagatttgaagaggttaaggaatacgtccgcagtggc
gtctttgggactagcaactatgatgaattgatgggttctttggaaggaaatgaaggttat
ggacgtgcagattattttcttgttggcaaggattttcccagttacattgaatgccaggaa
aaagttgatgaagcataccgagatcagaagctatggacaagaatgtctatcctcaacaca
gcgggttcccccaagttcagcagtgaccggacgatccacgagtacgccaaggacatatgg
gatatcagccctgtcatcatgccctga

KEGG   Aegilops tauschii (wheat D): 109760178Help
Entry
109760178         CDS       T04345                                 

Gene name
LOC109760178
Definition
(RefSeq) 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00500  Starch and sucrose metabolism
ats01100  Metabolic pathways
ats01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    109760178 (LOC109760178)
Enzymes [BR:ats01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     109760178 (LOC109760178)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: XP_020174597
Position
Unknown
AA seq 578 aa AA seqDB search
MALARTVPLPQLASASSLPRHRRCRLLLPAMSQARGPPARGIACRAATTTPAAVAAVGVG
EDLPEGYEQMMPTVEASQRRRAGVLLHPTSLRGPHGIGDLGDQAIAFLDWLHGAGCTLWQ
VLPLVPPGRKSGEDGSPYSGQDANCGNTLLISLEELVKDGLLMENELPDPLDMEYVEFDT
VANLKEPLIAKAAERLLQSPGELRRQYDEFKKNPDVSGWLEDAALFAAIDNSINAVSWSE
WPEPLKDRHPGALKDIYENQKDFIENFMAQQFLFEKQWKRVRSHAQKLGISIMGDMPIYV
GYHSADVWANRKSFLLDKNGFPTFVSGVPPDAFSKTGQLWNSPLYDWKSMEADGFAWWVK
RIKRALDLYDEFRIDHFRGLAGFWAVPSGSEVAMFGSWRAGPRNAFFDALFKAVGRINII
AEDLGVITEDVVELRKSIGAPGMAVLQFAFGGGPGNPHLPHNHELNQVVYTGTHDNDTAV
GWWQSLPEEEKQTVFKYLPQVSNLDVSWALIATALSSVARTSMVTMQDILSLGSSARMNT
PATQKGNWKWRIPSCVSFDSLSLEEAKLKELLTLYDRL
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcgcgcgaaccgtcccgctcccgcagctcgcttcggcctcgtccctcccccgg
caccgccgctgccgcctcctcctccccgcaatgtcgcaggcgcgcggcccccccgcgcga
gggatcgcctgccgcgccgcgacgacgacgccggccgcggtggcggcggtgggcgtcggg
gaggacctgcccgagggctacgagcagatgatgccgaccgtggaggcctcccagcggcgg
cgcgcgggggtcctgctgcacccgacgtcgctccgcggcccgcacggcatcggcgacctc
ggcgaccaggcaatcgcgttcctcgactggctccacggcgccggctgcacgctctggcag
gttcttccacttgttcccccgggaagaaaatccggggaggatggttctccttattcagga
caggatgcaaactgcggtaatacactattgatttctcttgaagagcttgttaaagatggg
ctgttgatggaaaacgaacttcctgatcctttagatatggaatatgttgaatttgacact
gttgctaatctgaaagaacctcttattgccaaggcagcagagaggctcctacagagccct
ggagagctcagaaggcagtatgacgaattcaagaaaaatccagatgtttcaggttggctt
gaagatgctgcacttttcgctgctatcgacaatagcatcaatgcagtgtcctggtctgag
tggcctgaaccgctgaaagatcgccatcctggagccttgaaagatatatatgaaaaccag
aaggactttatagaaaattttatggcacaacagttcttatttgaaaagcaatggaaacgg
gttcgttcacatgctcagaagctgggcatcagcataatgggtgacatgcctatatatgtt
ggctaccacagcgcagatgtttgggcaaacaggaaatcatttttgctggacaagaatggt
ttccctacatttgttagtggcgttccccctgatgcattcagtaaaactggtcagctatgg
aacagcccattgtatgactggaaatctatggaagcagatggctttgcatggtgggtaaag
aggattaaacgtgcccttgatttgtatgatgagttccgtattgaccatttccgggggctt
gctggtttttgggcagttccttcgggatcagaagtagcgatgtttggaagctggagggct
ggaccaaggaatgccttttttgatgcgctgttcaaagctgttggtagaataaatataatc
gctgaagacctgggggtgataaccgaagatgttgttgagttaaggaagtctattggggct
ccagggatggcagttcttcagttcgcttttggcggtggtcctggcaacccccacttacct
cataaccatgaattgaaccaagttgtatacactgggacacatgataatgatacagctgtt
ggctggtggcaaagtttaccagaggaagagaagcaaactgtgttcaagtatctaccgcag
gtcagcaacttggatgtctcttgggcgctaattgctactgctctctcttccgttgcaagg
acttccatggtaaccatgcaggacatactcagccttggcagctctgctaggatgaacact
ccagctacacagaaaggaaattggaaatggaggataccaagctgtgtcagcttcgacagc
cttagcctcgaagaagcaaagctgaaggagttgcttacgctgtacgaccggctgtga

KEGG   Aegilops tauschii (wheat D): 109768306Help
Entry
109768306         CDS       T04345                                 

Gene name
LOC109768306
Definition
(RefSeq) 4-alpha-glucanotransferase DPE2
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00500  Starch and sucrose metabolism
ats01100  Metabolic pathways
ats01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    109768306 (LOC109768306)
Enzymes [BR:ats01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     109768306 (LOC109768306)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_77 CBM_20
Motif
Other DBs
NCBI-ProteinID: XP_020182625
Position
Unknown
AA seq 922 aa AA seqDB search
MAKVTLIFKLPYYTEWGQSLIIAGSAPALGSWNVKQGLALSPVHEGNALVWCGQVSVPAV
FTCEYSYHVVDDHKNVLRREAGEKKKLVVPEGVKDGDVVEVRDWWQDASEALFLRSAFKN
VIFSATDNAKRQLQSPSLSKTLDPEDIVVQFIISCPRLAAGSTVVVTGSNLAVGNWKAQN
GLKLNYVGDSIWKAYCVLRKSEFPVKYKYCQVSEAGVSSLEFGPNREVDVDLSSPKPSRH
ILLSDGSLREAPWRGAGVAVPMFSIRSNEDLGVGEFPDLKLLVDWAVNSGFHLVQLLPIN
DTSVNKMWWDSYPYSSLSVFALHPLYLRVQALSDAIPADVKEEITKAKKELDKKDVDYEA
ALSTKLRIAQKIFNLEKDKVLNSAPFKQFLSENEEWLKPYAAFCFLRDFFETSDHSQWGR
FSQFSKEKLDKLVVADALHHDIIRFHYYVQYHLFTQLSDAATYARKNKVILKGDLPIGVD
RNSVDTWVNPTLFRMNTATGAPPDYFAKSGQNWGFPTYNWEEMSKDNYGWWRARLTQLSK
FFTAYRIDHILGFFRIWELPDHAATGLCGKFRPSIPLSQEELLGDGIWDFDRMSRPYIRQ
DMLEEKFGSLWTIVAANFLHEYQKHCYEFKEECNTEKKIITKIKTSPEKSLWLEKEDSIQ
RGLFDLLQNIVLIRDPEDSTKYYPRFNLEDTSSFRDLDEHSKNVLRRLYHDYYFVRQENL
WRQNALKTLPVLLDCSDMLACGEDLGLIPACVHPVMLELALIGLRIQRMPSEPGLEFDIP
SKYSYMTVCAPSCHDCSTLRAWWEGDEGTRSRFYKTVIGSDKEAPSRCTPEVVNFILQQH
FDAPSMWAIFPLQDLLALKDKYTARPAAEETINDPTNPRHYWRFRLHVSLESILEDKDIQ
ASIKNLVTSSGRSFPGKKTDKA
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagtgaccctgatcttcaagctaccgtactacacggaatgggggcagagcctc
atcatcgccggctccgcgccggcgctcgggtcctggaacgtcaagcaggggctggccctg
agcccggttcacgaggggaacgcgctggtctggtgcggccaggtttcagtcccggctgtc
ttcacctgtgagtacagctaccatgtggtggacgaccacaagaacgttctcagacgggag
gccggggagaagaagaagctagtggtgccggagggcgtcaaggacggcgacgtcgtcgag
gtccgcgactggtggcaggatgcttctgaagctcttttcctccgaagtgcgttcaagaac
gtcattttcagcgcaactgataatgctaaaaggcaactgcagtctccttccctcagcaaa
actttggatcctgaagatattgtcgtgcaatttattatcagttgtcctcggctagcagct
ggctctactgttgtcgtcacaggaagtaacctcgcggtaggaaattggaaagctcaaaat
ggcctcaagctcaactatgttggagattccatttggaaagcctactgtgtgttgcggaag
tctgagttcccagtaaaatataagtactgtcaagttagtgaagcaggagtctcttcattg
gagtttggcccaaacagagaggttgatgtggatttatcatcacccaagccatccagacac
atcttattatctgatggctccctccgggaagcaccatggaggggtgctggtgttgccgta
ccgatgttctcaatcaggtcaaatgaggatcttggtgttggagaattcccagatcttaaa
cttcttgttgactgggcagtaaattcgggttttcatcttgttcagctccttcctatcaat
gatacttctgttaacaagatgtggtgggattcatatccatatagctcactctccgtattt
gcgttgcaccccttgtacctgagagtgcaggcgctttcagatgctattccagcagatgtt
aaggaagagattacgaaggcaaagaaggagttggacaaaaaggacgtcgactatgaggca
gcgttgtccacgaaactcagaattgcccaaaaaatatttaatttagaaaaggataaagtg
ctaaattcagctccgttcaagcagttcttatctgaaaatgaggaatggttgaagccatat
gctgcattttgctttcttcgggatttcttcgagacatcagatcacagccagtggggtcgg
ttttctcagttttccaaggagaagcttgacaagctagtcgtagcagatgctttgcaccac
gatattatacgcttccactactatgtccaatatcatctatttacacaattatcagatgca
gctacatatgcaaggaagaacaaggttattctgaaaggagatttacctattggtgttgat
aggaacagcgtggatacttgggtaaaccctacattatttcgcatgaataccgctactggt
gcacctccagattactttgccaaaagtggacaaaattggggttttcctacatataactgg
gaggagatgtcaaaggataattatgggtggtggcgagctcgtctgacacagctatcaaaa
ttcttcacagcgtataggatagaccatattttgggtttctttaggatctgggagcttcca
gatcatgctgccacaggtctatgtggaaaatttagaccttcaattcctcttagtcaggag
gagcttctaggtgatggtatctgggattttgatcggatgagccgcccatatattcgtcag
gacatgctggaggagaagtttggatctctttggacaattgttgcagccaactttctgcac
gagtatcagaaacactgctatgagttcaaagaggaatgcaacaccgagaaaaagattatt
acaaagattaaaaccagtcccgaaaaatcactctggctggagaaagaagacagtattcag
cgtggtctgttcgatcttctacagaatatagtcctcatcagagatcctgaggactccaca
aagtactatccccgttttaacctggaagatacttcaagttttagggacttagatgaacat
agcaaaaatgtccttagaagattataccatgactattatttcgttcgccaagaaaatctt
tggcgacaaaatgcactgaagactctacctgttctattggactgttcggatatgttggca
tgcggggaagatcttggccttatccctgcttgtgttcaccctgttatgctagaactcgcg
ttgattggattgcgtatccagagaatgcctagcgaaccaggcttggaatttgatattccg
tccaagtacagctatatgacggtttgtgctccctcatgtcatgattgctccacattacgt
gcttggtgggaaggagatgaagggacaagaagtcgtttttacaagactgtaattggcagc
gacaaagaggccccatctcgttgcaccccagaagtagtgaacttcattcttcagcagcat
ttcgatgcaccgtcaatgtgggcaatctttccgctacaggatctgctcgctctgaaagac
aaatacaccgcaagaccagcagcggaggaaacaatcaacgatcccactaacccgaggcac
tattggagattccgcctacatgtgtcactggagtccatactggaggacaaggacatccag
gcgagcatcaagaacctcgtcacaagcagcgggaggtcattccctggcaagaaaacggac
aaggcctag

KEGG   Aegilops tauschii (wheat D): 109783450Help
Entry
109783450         CDS       T04345                                 

Gene name
LOC109783450
Definition
(RefSeq) 4-alpha-glucanotransferase DPE2-like
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00500  Starch and sucrose metabolism
ats01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    109783450 (LOC109783450)
Enzymes [BR:ats01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     109783450 (LOC109783450)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: XP_020197648
Position
Unknown
AA seq 226 aa AA seqDB search
MFFYSKNVLRRLYHDYYFVRQENLWRQNALKTLPVLLDCSDMLACGEDLGLIPACVHPVM
LELALIGLRIQRMPSEPGLEFDIPSKYSYMTVCAPSCHDCSTLRAWWEGDEGTRSRFYKT
VIGSDKEAPSRCTPEVVNFILQQHFDAPSMWAIFPLQDLLALKDKYTARPAAEETINDPT
NPRHYWRFRLHVSLESILEDKDIQASIKNLVTSSGRSFPGKKTDKA
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtttttttacagcaaaaatgtccttagaagattataccatgactattatttcgttcgc
caagaaaatctttggcgacaaaatgcactgaagactctacctgttctattggactgttcg
gatatgttggcatgcggggaagatcttggccttatccctgcttgtgttcaccctgttatg
ctagaactcgcgttgattggattgcgtatccagagaatgcctagcgaaccaggcttggaa
tttgatattccgtccaagtacagctatatgacggtttgtgctccctcatgtcatgattgc
tccacattacgtgcttggtgggaaggagatgaagggacaagaagtcgtttttacaagact
gtaattggcagcgacaaagaggccccatctcgttgcaccccagaagtagtgaacttcatt
cttcagcagcatttcgatgcaccgtcaatgtgggcaatctttccgctacaggatctgctc
gctctgaaagacaaatacaccgcaagaccagcagcggaggaaacaatcaacgatcccact
aacccgaggcactattggagattccgcctacatgtgtcactggagtccatactggaggac
aaggacatccaggcgagcatcaagaacctcgtcacaagcagcgggaggtcattccctggc
aagaaaacggacaaggcctag

KEGG   Aegilops tauschii (wheat D): 109785836Help
Entry
109785836         CDS       T04345                                 

Gene name
LOC109785836
Definition
(RefSeq) alpha-glucan phosphorylase, H isozyme
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00500  Starch and sucrose metabolism
ats01100  Metabolic pathways
ats01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    109785836 (LOC109785836)
Enzymes [BR:ats01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     109785836 (LOC109785836)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphorylase
Motif
Other DBs
NCBI-ProteinID: XP_020200014
Position
Unknown
AA seq 832 aa AA seqDB search
MSAADKVKPAASPASEDPSAIAGNISYHAQYSPHFSPLAFGPEQAFYATAESVRDHLLQR
WNDTYLHFHKTDPKQTYYLSMEYLQGRALTNAVGNLAITGAYADALKKFGYELEAIAGQE
RDAALGNGGLGRLASCFLDSMATLNLPSWGYGLRYRYGLFKQRIAKEGQEEIAEDWLDKF
SPWEIVRHDVVYPIRFFGHVEISPDGKRKWAGGEVLNALAYDVPIPGYKTKNAISLRLWD
ATATAEDFNLFQFNDGQYESAAQLHSRAQQICAVLYPGDATEEGKLLRLKQQYFLCSASL
QDIIFRFKERKADRVSGKWSEFPSKVAVQMNDTHPTLAIPELMRLLMDVEGLGWDEAWAV
TNKTVAYTNHTVLPEALEKWSQAVMRKLLPRHMEIIEEIDKRFREMVISTRKDMEGKIES
MRVLDNNPEKPVVRMANLCVVAGHTVNGVAELHSNILKQELFADYVSIWPNKFQNKTNGI
TPRRWLRFCNPELSEIVTKWLKTDQWTSNLDLLTGLRKFADDEKLHAEWAAAKLASKKRL
AKHVLDVTGVTIDPNSLFDIQIKRIHEYKRQLLNILGAVYRYKKLKEMSAEERKKVTPRT
VMVGGKAFATYTNAKRIVKLVNDVGAVVNNDADVNQYLKVVFIPNYNVSVAEVLIPGSEL
SQHISTAGMEASGTSNMKFSLNGCVIIGTLDGANVEIREEVGQDNFFLFGAKADQIAGLR
KERENGLFKPDPRFEEAKQFIRSGAFGTYDYTPLLDSLEGNTGFGRGDYFLVGYDFPSYI
DAQARVDEAYKDKKKWIKMSILNTAGSGKFSSDRTIDQYAKEIWGISACPVP
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcggcggacaaggtgaagccggcggccagcccggcgtcggaggatccctccgcc
atcgccggcaacatctcctaccacgcgcagtacagcccccacttctcgccgctcgccttc
ggccccgagcaggccttctacgccaccgccgagagcgtccgcgaccacctcctccagaga
tggaacgacacctacctgcatttccacaagacggaccccaagcagacctactacctgtcc
atggagtacctgcagggccgcgcgctcaccaacgccgtcggcaacctcgccatcaccggc
gcctacgctgacgccctgaagaagttcggctacgagctcgaggccatcgctggacaggag
agggatgctgctctgggaaatggtggcttgggcaggcttgcatcttgctttttggattca
atggcaacgctgaacttgccttcttggggctatggccttcgttaccgatatggcctgttc
aagcagcgcattgccaaggagggccaagaagaaatcgctgaagactggcttgataagttt
agcccatgggagattgtcaggcatgatgttgtatacccaatcagatttttcggccatgtc
gagatttcgccagatggaaagcggaaatgggccggtggagaagttctgaacgctttagcc
tatgatgtgccaattcctgggtacaagacaaaaaatgcaatcagtcttcgcctttgggat
gcaacagctactgctgaggatttcaacttatttcagttcaatgatggccagtatgagtca
gctgctcaactgcactcgagggcacagcagatatgtgctgttctctatcctggtgatgct
acagaagaagggaagcttctgagattaaagcagcagtatttcctttgcagcgcatcactt
caggatattattttcagatttaaagaaagaaaagctgacagagtttcagggaagtggagt
gagttcccttccaaagttgctgttcaaatgaatgacactcacccaactcttgccatccct
gagctaatgaggttgcttatggacgtggagggacttggttgggatgaagcctgggctgtc
acaaataagacggttgcttacaccaatcacacagttcttcctgaagctctcgagaaatgg
tcacaggctgtaatgaggaaattgcttccgcgtcacatggaaatcatcgaggaaattgac
aagcggtttagagaaatggtaatctccacccggaaggatatggagggaaagatcgaatcg
atgagggttttagataacaatcctgagaagccagtagtgcggatggcgaatttgtgtgtt
gtggctgggcatacggtgaatggagtggccgagttgcacagcaacatcttgaaacaagag
ctgtttgcagattatgtctctatttggcctaacaaattccagaacaaaactaatggaatt
acaccacgtagatggctccgtttttgcaaccctgagctgagtgaaatagtcacgaaatgg
ttaaaaacagatcagtggacaagcaaccttgatcttctcaccgggcttcgcaaattcgca
gatgatgaaaaactacatgctgagtgggcagcagccaagctggccagcaaaaagcgctta
gccaagcatgtgttggatgtgactggtgttacaattgatccaaatagccttttcgatata
caaattaaacgcatccacgaatacaagagacagctgttgaacattttgggagctgtgtac
agatacaagaagttaaaggaaatgagcgcagaagagaggaagaaggttacaccacgcact
gtcatggtaggagggaaagcatttgcaacatacaccaatgctaaaagaatagtgaaattg
gtaaatgatgttggtgctgtggtgaacaatgatgctgacgtcaaccaatatctgaaggtg
gtgttcattccaaactacaacgtatcagtggctgaagtgctcattcctggcagtgaactg
tcacagcacatcagtactgcaggcatggaagcaagtggaacaagtaacatgaagttctct
ctgaatggctgtgttatcattggaactctcgatggagccaatgttgaaatcagagaagaa
gtagggcaagacaacttcttccttttcggtgccaaagcagatcagattgctggtctgagg
aaggaaagggaaaatggcttgttcaagccagacccacgctttgaagaagccaagcagttt
atcaggagtggtgctttcggcacctacgactacactcctctcttggattcccttgaaggg
aacactggatttgggcgtggtgactacttccttgttggctatgacttcccaagctacatt
gatgcacaggcccgggttgatgaagcctacaaggacaagaagaaatggatcaagatgtcc
atcttgaacacggctggaagtggcaagttcagcagcgaccgcaccatcgaccaatatgcg
aaggagatctggggcatttcggcttgccctgttccatga

DBGET integrated database retrieval system