KEGG   Aegilops tauschii (wheat D): 109744068Help
Entry
109744068         CDS       T04345                                 

Gene name
LOC109744068
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00010  Glycolysis / Gluconeogenesis
ats00562  Inositol phosphate metabolism
ats01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109744068 (LOC109744068)
   00562 Inositol phosphate metabolism
    109744068 (LOC109744068)
Enzymes [BR:ats01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     109744068 (LOC109744068)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     109744068 (LOC109744068)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-ProteinID: XP_020158755
Position
Unknown
AA seq 517 aa AA seqDB search
MAPPATPLPFLVLLATLLAAAPLLPPAAAAEPEAFDVRRHLSTVTRYDVSRASNSVVSAP
AISDECRVIHLNLVARHGTRAPTKKRIKELDRLAVRLGTLVDEAKQGPDTASLKKIPSWM
KGWESRWKGRVKGGELVSEGEEELFNFANRVKERFQDLFDEEYHPDVYSIRATQVPRASA
SAVAFGLGLLSGKGKLGAGNNRAFSVLSESRASDICLRFFDSCKTYKDYRKRKEPDVDKQ
KEPILEHVTSALVSRYHLKFTTQDVSSLWFLCKQEASLLNITNQACQLFNEDEVHLLEWT
DDLEGFVLKGYGESINYKMGLPLLKDVVQSMEEAIIAKEENFPDGTYEKARLRFAHAETL
VPFTCLLGLFLEGSDFEKIQREEPLDLPPMPPQRRNWKGALVAPFASNNMLALYQCPGND
GKKTSQDQKNSYFVQVLHNEAPVSMPGCGNKDLCPFEEFKEKIVKPHLEHDYDMLCKKPV
AAADEEPSSFSSKLNFFLDLLSRKGYRVKGQDVKTEL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggctcctccggccacgcctctccccttcctcgtcctcctcgccacgctcctcgcggcc
gcccccctcttgccgccggcggcggcggccgagcccgaggccttcgacgtccgccgccac
ctctccaccgtcaccaggtacgatgtgtccagggcgtccaacagcgtggtctccgcgccg
gctatctccgacgagtgccgcgtgatccacctcaatctcgtcgcaagacatgggactcgt
gctcctaccaagaagagaatcaaggagttggataggctggctgtgcggttggggacttta
gtggatgaggcaaaacaaggacctgacactgcttctctgaagaaaattccatcatggatg
aaggggtgggagtcacgttggaagggtagggtcaaagggggtgaactggttagcgaaggt
gaggaagagctgttcaattttgccaaccgagtgaaggagaggtttcaagacctgtttgat
gaggaatatcatccagacgtgtactcaataagagcaacccaggttcctcgagcatcagct
agtgcagtagcatttggtttggggctactttctgggaaaggaaagcttggagcaggaaat
aaccgtgccttctctgttctgagcgagagtcgtgcaagtgatatttgtctgcgattcttt
gatagctgtaaaacatacaaggactacaggaaaagaaaggaacctgatgttgacaagcaa
aaggaaccaattctagaacatgtcacatctgctttagtcagccgttatcacctcaagttt
acaacacaggatgtttcttccctctggttcctctgcaaacaggaagcatctttactgaat
attaccaatcaagcttgtcaacttttcaatgaagatgaggttcatttgctagagtggaca
gatgatttggagggttttgtgcttaaaggttatggtgagtcaataaactacaaaatggga
ctgccattgctcaaggatgttgtccaatcaatggaagaagcaatcatagctaaagaagag
aacttccctgatggtacgtatgagaaggcaaggctccgatttgcacacgcagaaactctt
gttcctttcacatgtctactaggtctttttcttgaaggatcagattttgagaagatacag
cgggaggagccattggatctacctccgatgccaccacagagaagaaattggaagggcgca
cttgtagcaccttttgctagcaacaatatgttggctttataccaatgccctggcaatgat
ggcaaaaaaacatctcaggaccaaaaaaattcatattttgtgcaagttctacacaatgaa
gccccagtttcgatgccgggctgcggcaacaaggatttatgcccgttcgaggagttcaag
gaaaagatagtgaagccgcacctggagcacgactacgatatgctatgcaagaagccggtg
gcggcagcagacgaggagccatcctctttcagctccaagctcaacttcttcctggacctg
ctctcgcggaaaggttaccgtgtaaaggggcaagatgttaagacggaactgtag

DBGET integrated database retrieval system