KEGG   Aegilops tauschii (wheat D): 109746106Help
Entry
109746106         CDS       T04345                                 

Gene name
LOC109746106
Definition
(RefSeq) receptor like protein kinase S.2-like
Organism
ats  Aegilops tauschii (wheat D)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr YukC Kinase-like
Motif
Other DBs
NCBI-ProteinID: XP_020160812
Position
Unknown
AA seq 1047 aa AA seqDB search
MDFKLQLLEAITDNFSEEQKLGSGDYGEVYRAVLDNGEYIALKKLHQLQGLDDKQFRSGF
RDLVRVSHKNVVRLIGYCHESRKKYVEHKGELTLAKITERVLCFEYMHGGSFDKHIADES
CELDWPICYKIIKGTCEGLNHLHTKQEKPIFHLDLKPSNILLDESMTPKISDLGLSILVS
STKTHETEILRGTQGYMPPEYRDSGLVSNKFDVFSLGIIIIKTVAGNMGYFRYSEMSHKD
FIEFVSENWMKRWQAMPGYYSSHEIDILTVITCIETALRCVDTDQKKRPCIEDIVHELDE
LEAEIKKIRLLAPDPMQILLSNQGPGMEFPKISRLCTAHNLAHYKRILDFKFGLIEAITN
GFSDDQKIGSDGYGDVYRALYNGEEILVKKLHSLEGLDDKEFENEMHILTKVHHKNVGRL
IGYCYKTCLINVERNAEHASSVATERVLCFEYTQSGSLDKHIADEPACRLDWSTLYKIIK
GTCEGLNHLLSAHQKPILHLDLTPANIFLVKGKTPKIIGFGLWRLIDSTKMHQTKIFKET
HGYMPPEYVDTGFISNKFDVFSLGAIIIKLMAGNMGYSRCFEMSPKDFIQHVSDNCTKRL
HAMPGYSPYEIDILRVSTCVEIALRCVDEDREKRPCIEDIVHKLGELEARVKTIMLLPHD
HRQSLLTDLDPGLYSPKESRLYMSHKLAQDGAVTGYKSNWSRIDSQSGATSTAHGQSKDL
SLQTGSIPQYMSLQHLRDITNNFSDERIIGRGGFYVVYKGVQQNAKMVAVKKLVHPTVST
QVEFEKEVKLLMKLKHPNIVQQVGYCYETQNLYMVHEGKCIFAEYTHTLLCLELLKNGSL
DKYISAACSGLDWHGRCKIIEGVSYGLEYLHEQSKEPILHLDLKPANILLDVNMLPKITD
FGLSRLFDQSRTIQTANTSGTLGYMAPEYLRGIITPMSDIFSLGVIILEVITGHRDYPYD
IRSSSKEFIEHELQNWRNRLQKEPGSRSLETDCQQIKKCIQIGLICVNPERTKRPTMKKI
IDMLEGLESTDWYINNQLSSHEIQEEL
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atggactttaaactccagttgcttgaagctattacagacaacttttcagaggaacagaag
cttggcagcggcgattatggagaagtttacagggcggtgcttgataacggggaatatatt
gctctgaagaagcttcatcaattacaaggacttgatgataagcaatttcgcagtggattc
cgtgaccttgtcagggtctctcacaaaaatgttgtacgcttaattggctactgccacgaa
tctcggaagaaatacgttgagcacaagggggaacttactttggctaaaataactgagaga
gttctctgcttcgagtatatgcatggcgggagcttcgataaacatattgcagatgaatct
tgtgaacttgattggcccatttgttacaaaatcattaaagggacgtgcgaggggttaaat
caccttcacaccaagcaggaaaagcctattttccatctggatttaaagccttctaacata
ttgctggatgagagcatgacgcccaaaatttcagatcttggtctgtccatacttgtttct
tcgacaaaaacgcacgaaacagagatactcagaggcacacaagggtacatgccgccagaa
tacagagatagtggcttggtatcaaacaagtttgacgtgttcagtttgggcatcataatt
ataaaaacagtggctggaaatatgggctacttccgttattctgaaatgtctcataaagat
tttattgagtttgtaagtgaaaattggatgaagaggtggcaggcaatgccgggttactat
tcatcacatgaaatagacatcctaacagtgattacatgtattgagaccgcattaagatgt
gtcgataccgaccaaaaaaagaggccctgcatagaggatattgtccatgaactggacgaa
ctagaagctgagattaagaaaataaggttactagctcctgatcctatgcagattctcttg
agtaatcaaggccctggcatggagtttccaaaaatttccaggctatgtacggcccataac
ttggcccactataagcgcatcctggattttaaattcggtttgattgaagctattacaaac
ggtttttcagatgatcagaaaattgggagtgatgggtatggagatgtttacagggcattg
tacaatggggaagagattcttgtgaagaagcttcattccttggagggacttgatgacaaa
gaatttgagaatgaaatgcatatccttaccaaggtccatcacaaaaatgttggtcgttta
attggctactgctacaaaacttgccttataaatgttgagcgcaatgcggaacatgcttcc
tcagtggcaacggagcgagttctatgctttgaatatacacaaagtggaagccttgataaa
catattgcagatgaaccagcttgccgacttgattggtccacactttacaaaattattaaa
gggacttgtgagggcttaaatcaccttctcagtgcacatcaaaaacctattctccatcta
gacttgacaccggctaacatttttctggttaagggcaagacacctaaaattataggtttt
ggtttgtggagacttattgattcgacaaaaatgcatcaaacaaagatcttcaaagaaaca
cacgggtacatgccaccagaatatgtcgacactggctttatatcaaacaagtttgacgtg
ttcagtttgggtgccataattataaagctgatggccggaaatatgggctactctcgttgt
ttcgaaatgtcccccaaagattttattcaacatgttagtgacaattgcacgaaaaggttg
catgcaatgccaggatattcaccatatgaaatagacatcctacgagtgagtacatgtgtt
gagattgcattaagatgtgtggacgaagaccgagagaaaaggccctgtatagaagacatt
gtccataaactgggggaactagaagctagggttaagacaataatgttactacctcatgat
cataggcaaagcctcttgactgacctggaccctggcttgtactctccaaaagaaagcagg
ctatatatgtcccataagttggcccaagatggagctgttacagggtataaatcaaattgg
tccaggattgattctcagtctggcgccaccagcactgctcatggtcagtcaaaagaccta
agtctccagacggggtctattccacaatatatgtccttacaacatctaagagacatcaca
aacaacttctctgatgagcgaataattggtagaggtggtttctatgtggtatataaggga
gtgcaacaaaatgcgaaaatggttgcagtgaagaagcttgtgcatccaacggtgagcaca
caggtggaatttgagaaggaggttaaactccttatgaaactaaagcacccaaatatagtg
caacaagtaggctactgctatgaaacacagaatctgtatatggttcatgaaggaaaatgc
atttttgctgagtatactcacactttgctttgcttagaacttctgaagaacggaagtctt
gataagtatatttcagctgcatgttctggacttgattggcacggacgctgcaaaataatt
gagggggtttcctatggtctagagtaccttcatgagcaatctaaagaacccattcttcac
ttggacctaaaacctgcgaacatattgcttgatgtcaatatgctgccaaaaattacagat
tttggtctgtcaagactatttgatcaaagccgaactattcagactgcaaatactagtgga
acactaggttacatggcgccagaatacctgcgaggtataatcacacctatgtcagacata
ttcagtttgggtgttataatcttggaggtaataacagggcacagggactacccatatgat
attagatcatcttccaaggaattcatcgagcacgagcttcaaaactggagaaataggctg
caaaaagaaccagggtctagatcgctagaaacagattgccaacaaataaaaaaatgcatt
cagataggtctaatctgcgtgaatcctgagcggaccaaaagacctacaatgaagaaaatt
attgatatgcttgaaggcttggaaagtacggattggtacattaacaatcagttatcaagc
catgaaatccaagaggagctatag

DBGET integrated database retrieval system