KEGG   Aegilops tauschii (wheat D): 109748005Help
Entry
109748005         CDS       T04345                                 

Gene name
LOC109748005
Definition
(RefSeq) probable pyruvate, phosphate dikinase regulatory protein, chloroplastic isoform X1
  KO
K20115  [pyruvate, phosphate dikinase]-phosphate phosphotransferase / [pyruvate, phosphate dikinase] kinase [EC:2.7.4.27 2.7.11.32]
Organism
ats  Aegilops tauschii (wheat D)
Brite
KEGG Orthology (KO) [BR:ats00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109748005 (LOC109748005)
Enzymes [BR:ats01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.27  [pyruvate, phosphate dikinase]-phosphate phosphotransferase
     109748005 (LOC109748005)
   2.7.11  Protein-serine/threonine kinases
    2.7.11.32  [pyruvate, phosphate dikinase] kinase
     109748005 (LOC109748005)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinase-PPPase
Motif
Other DBs
NCBI-ProteinID: XP_020162647
Position
Unknown
AA seq 452 aa AA seqDB search
MMSAKLGAATPSVLLTPSPRPHGLRPSPTAASCLPDTATGPPLSAGPDQEHSGAPGQEEA
AVSSPSQPRSRASSQLSRWSRARALRSGRRLELPAIRASAALEVPTKSPPPTEQEATATE
DDDDGDEAVGVGSEAAGNSIYMVSDGTGSTLEHSVNAVLGQFEHCLVDRRCATSTHLFSG
IDDMDNLIEIVRQAAKEGALLLYTLADPSMAEATKKACDLWGVPCTDVLRPTIDAIASHI
GVAPSGISRSSASRKGQLSEDYFQRIEAIDFTIKQDDGAQPQNLARAHIVLVGVSRTGKT
PLSIYLAQKGYKVANVPIVMGIDLPKALFEIDQDKIFGLTINPVVLQAIRKTRANTLGFH
GQKSNYAEMEHVRQELDHANQIFVRHPTWPVIQVTGKAVEETAAVIVRIYHDRKQKCSMP
RISKRQYISGQMCFNQNVASLPDQGHLEPDLW
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcgccaagctcggcgcggcgacgccgtccgtgctcctcacgccctcccctcgg
ccccacggcctccgcccctcccccaccgccgcgtcatgcctccccgacaccgccaccggc
ccgcctctaagcgcgggaccggaccaagagcactctggcgcgcccgggcaagaggaggcg
gcggtctcctccccctcccagccgcgctcgcgagcgagctcgcagctgagccgctggtcc
cgcgcgcgcgctctccggtccggccggaggctggagctgccggccatacgggcgagcgcg
gcgctcgaggtgccgaccaagtcgccgccgcccaccgagcaggaggccacagcgacggag
gacgacgacgatggcgacgaggcggttggggtcggaagcgaggcagcggggaactcgatc
tacatggtgtcggacgggacgggttcgacgttggagcactcggtgaatgccgtgctcggg
caattcgagcactgcctcgtcgaccgccgctgtgccacaagcacccacctcttctctggg
attgatgacatggacaaccttattgagatagtcaggcaagcagcaaaagaaggagcattg
cttctatatacccttgccgatccttcaatggctgaggcaactaagaaggcttgtgattta
tggggtgttccatgcaccgatgttcttcgtcctactattgacgccatagcttctcatatt
ggtgttgctccatctggaatttcacgaagctctgctagccgaaagggtcaactttctgag
gattacttccaacgaatcgaagcaattgatttcaccatcaaacaagatgatggtgctcag
ccacagaaccttgcccgtgcacacattgtgcttgttggtgtttcacgtaccgggaagaca
ccattgtcaatttatcttgcacaaaaagggtacaaagtggcaaacgtcccaattgtgatg
ggtattgatcttccaaaggccctatttgagatcgaccaggataagatctttgggttgacg
ataaaccccgtggttcttcaggcaatcagaaagacaagagcaaatactctaggatttcat
gggcagaagagcaattatgctgaaatggagcacgtgaggcaggagctcgaccatgcaaat
caaatttttgttcggcacccaacatggccagtgatccaggtcactggaaaagctgtagag
gaaacagctgctgtcattgttagaatataccatgacaggaaacagaagtgctccatgcca
cgcatatcaaaacgacaatacatatctggtcagatgtgcttcaaccaaaatgtagcttct
ctaccagaccagggccaccttgaaccagacctgtggtaa

DBGET integrated database retrieval system