KEGG   Aegilops tauschii (wheat D): 109748562Help
Entry
109748562         CDS       T04345                                 

Gene name
LOC109748562
Definition
(RefSeq) acetyl-CoA acetyltransferase, cytosolic 1-like
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00071  Fatty acid degradation
ats00072  Synthesis and degradation of ketone bodies
ats00280  Valine, leucine and isoleucine degradation
ats00310  Lysine degradation
ats00380  Tryptophan metabolism
ats00620  Pyruvate metabolism
ats00630  Glyoxylate and dicarboxylate metabolism
ats00640  Propanoate metabolism
ats00650  Butanoate metabolism
ats00900  Terpenoid backbone biosynthesis
ats01100  Metabolic pathways
ats01110  Biosynthesis of secondary metabolites
ats01200  Carbon metabolism
ats01212  Fatty acid metabolism
Module
ats_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    109748562 (LOC109748562)
   00630 Glyoxylate and dicarboxylate metabolism
    109748562 (LOC109748562)
   00640 Propanoate metabolism
    109748562 (LOC109748562)
   00650 Butanoate metabolism
    109748562 (LOC109748562)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109748562 (LOC109748562)
   00072 Synthesis and degradation of ketone bodies
    109748562 (LOC109748562)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109748562 (LOC109748562)
   00310 Lysine degradation
    109748562 (LOC109748562)
   00380 Tryptophan metabolism
    109748562 (LOC109748562)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    109748562 (LOC109748562)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ats04147]
    109748562 (LOC109748562)
Enzymes [BR:ats01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     109748562 (LOC109748562)
Exosome [BR:ats04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109748562 (LOC109748562)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt MG4
Motif
Other DBs
NCBI-ProteinID: XP_020163181
Position
Unknown
AA seq 418 aa AA seqDB search
MAPPPTTSAPDGGLDPRDVCVVGVARTPIGALLGSLSSLPATRLGSVAIQGALRRASVDP
ALVQEVFMGNVLSANLGQAPARQAALGAGLPNTVPCTTVNKVCSSGMKAVMLAAQSIQLG
INDVVVAGGMESMSNAPKYAATARRGSRFGHDVLIDGMLKDGLWDVYNDFHMGMCAELCA
DQHSITREEQDAYAVQSNEHGIAARDSGAFDWEIVPVEIPSGRGRPPVVVDKDESLAKYD
PVKLKKLGPAFKKNGSVTAGNSSSISDGAAAIVLVSGEKAKNLGLQVLARIRGYADAAQA
PELFTTTPALAIPKAISNSGLRDSQIDYYEINEAFSVVAVANQRLLGISPGKLNISGGAV
SLGHPIGCSGARIIVTLLGILRQKQGKFGVAGVCNGGGGASAIVVESMQASSRLRSSL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgcccccgaccactagcgcccccgacggcggcctggatcccagggacgtgtgc
gtcgtcggcgtcgcccgcacgcccatcggcgccctgctcggctccctctcctccctcccc
gccaccaggctcggctccgtcgccatccagggcgctctccggcgagccagcgtcgacccg
gcgctggtgcaggaggtgttcatgggcaacgtcctcagcgccaacctcggccaggccccc
gccaggcaggccgccctcggcgccggcctgcccaacaccgtcccctgcaccaccgtcaac
aaagtctgctcctcagggatgaaggctgtcatgcttgcggcacagtcgattcagctgggg
atcaacgacgtcgtggtcgccggcggcatggagagcatgtccaatgcccccaaatacgct
gcaacggcaagacgaggatcgcggtttgggcatgacgtcctcatcgacgggatgctcaag
gatgggctgtgggatgtgtataatgatttccatatggggatgtgcgctgagctctgtgca
gatcagcactcgattacaagggaggagcaggatgcttatgctgtccagagcaatgagcac
ggaatagcagctcgagacagcggcgcgtttgattgggaaattgttccggttgaaattcct
tctggtagaggcagaccgccagttgttgttgacaaagatgagagtcttgcaaagtacgat
ccagtgaagctgaagaaacttgggccggcttttaagaagaatggctctgtaactgccggc
aattcttctagtataagcgacggtgctgctgcaattgtgctagtcagtggggagaaagcc
aagaaccttggccttcaagttcttgcaaggatcagagggtacgctgatgctgctcaggca
cctgagctatttacaacaactccagctcttgctatcccaaaggctatatcaaactcaggt
ctccgagattcacaaatagattattatgagataaatgaggctttctcggttgttgcagtg
gcaaatcagagacttcttggcatctctcctggaaaactgaatataagtggtggcgctgtt
tccctgggccatcctatcggttgcagtggtgcacgaatcatagtcaccttgctcgggatt
cttagacagaaacagggcaagtttggggttgccggagtatgcaacggcgggggtggtgct
tcagccatcgtcgtagagtccatgcaagcttcgtcgcgcctgcgatcctcgctgtga

DBGET integrated database retrieval system