KEGG   Aegilops tauschii (wheat D): 109748756Help
Entry
109748756         CDS       T04345                                 

Gene name
LOC109748756
Definition
(RefSeq) probable N6-adenosine-methyltransferase MT-A70-like
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
ats  Aegilops tauschii (wheat D)
Brite
KEGG Orthology (KO) [BR:ats00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ats03019]
    109748756 (LOC109748756)
Enzymes [BR:ats01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     109748756 (LOC109748756)
Messenger RNA biogenesis [BR:ats03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     109748756 (LOC109748756)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70 Macro
Motif
Other DBs
NCBI-ProteinID: XP_020163368
Position
Unknown
AA seq 702 aa AA seqDB search
METKADVAAAGGDDLSTMREQCRSMEEAISFRREAQLGLVGSLQHLVPDLVPSLDRSLRL
IAAFNDRSFTPTPNPNAGDPQNPSLKPHHRRAVPDPTRSTRRKTSPGSSPASAAVGGAAP
GGLDAVRTMVAVFLLELIPFAEIDAAVLARRLQAESSSASDAERAALADLATELGGSVPA
AVALALRRIAEDSGGVQIEEAMIGGKQMMMVWAIDRSKLLKELPESATLLSPQPPPIPQA
TSSETDANTAIIPRPPPPHQQQQPDMWAHSMPPMFPRPRGMTMAGMQRMVPGLMPLQRPF
MAPSPGPSPTQQNQRTEEEDLKDLEVLLSKKTYKEKQNTKTGEELLDLIHRPTAKETAVA
AKFKTKGGSQLKEYCTNLTKEDCRRQSGSFVSCAKVHFRRIIAPHTDTNLGDCSFLDTCR
HTKTCKYVHYELDQTPDIAPMMAGTLAPPRQIKPHRAEYCSEIELGESQWINCDIRNFRM
DILGQFGVIMADPPWDIHMELPYGTMADDEMRTLNVPALQTDGLIFLWVTGRAMELGREC
LELWGYKRVEEIIWVKTNQLQRIIRTGRTGHWLNHSKEHCLVGIKGSPLVNRNIDTDVIV
AEVRETSRKPDEMYAMLERISPRTRKLELFARMHNTQAGWLSLGNQVSGTRLVDEGLRAR
YKAAYPDFEVQPPSPPRASAPMDVDQSTPSQKPVASDGERPT
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggagaccaaggccgacgtcgccgccgccggcggcgacgacctctcgaccatgcgcgag
cagtgccggagcatggaggaggccatctccttccgccgcgaggcgcagctaggcctcgtc
ggctccctccagcacctcgtcccggacctggtcccctccctcgaccgttccctccgcctc
atcgccgccttcaacgaccgctccttcacccctaccccaaatcccaacgccggcgacccc
cagaaccccagcctgaagccccaccaccgccgcgccgtccccgacccgacccgctccacc
cgccgcaagacctctccggggtcctccccggcctccgccgccgtgggaggcgctgccccc
ggcggtctcgacgcggtacgcaccatggtggccgtattcctcctcgagcttatccccttc
gccgagatcgacgccgccgtgctcgcacgccgtctacaggctgaatcctcctcagccagc
gatgcggagcgggcggctcttgccgacctagcgacggagctcggcggctccgtgcccgcc
gctgtagctctcgccctccgacgcatagctgaggacagcggcggcgtgcagatcgaggag
gccatgattggaggcaagcagatgatgatggtctgggccatcgaccgtagcaagctcctc
aaagagctaccagaatccgccacattgttgtcaccccaacctccacccataccacaggcg
acctcgtccgagaccgacgctaacactgcaatcataccaagaccaccaccaccacatcag
cagcaacagccggatatgtgggcacactcgatgccaccgatgttcccacggcccaggggc
atgacaatggcggggatgcagaggatggtgccagggttgatgccgcttcagcgcccgttc
atggctccaagtccggggcctagtcctacccagcagaaccagaggaccgaggaggaggac
ctgaaggaccttgaggtgctgctgagtaagaagacatacaaggagaagcagaacacaaaa
actggggaggagctgctggatctcattcaccggccaacggcaaaggagacggctgttgca
gcaaagttcaaaacaaagggtggttcccagctgaaggagtattgcaccaatttaactaaa
gaagattgcagacgccaatctggttcctttgtttcctgtgctaaggttcactttcgccgt
attattgctccacatactgatacaaatctaggagattgctcttttctggacacctgccgc
cacactaagacttgcaagtatgtccactatgagcttgatcaaacaccagatatagctcca
atgatggctggcacccttgctccccctaggcaaataaagccccatagagctgaatattgt
tcagaaatagagcttggagagtcacaatggataaactgtgacattcggaacttcagaatg
gacatcttaggccaatttggggtaattatggctgatcccccgtgggatattcatatggaa
ctcccatatggcacaatggctgacgatgaaatgaggactcttaatgtgcctgctttacaa
acggatggtttaattttcttatgggtcaccggccgtgcgatggaacttggccgggagtgt
ttggagctctggggttacaagcgtgttgaggaaattatttgggtgaagaccaatcaactt
caacgcattattcgaactggccgcactggccattggttgaaccacagtaaagaacattgt
cttgttggaattaaagggagtcccctagtgaacaggaatatagacactgatgttattgtt
gctgaagtgcgtgaaacaagcagaaaacctgacgagatgtacgccatgctagagcggata
agcccaaggacaaggaaactcgaactgtttgctagaatgcataacacgcaagctggatgg
ctctctcttggcaaccaggtaagcggaacaaggcttgtggatgaagggctgagggcaagg
tacaaagctgcttatccggacttcgaggtgcagccgccatcgcctcccagagcaagcgcg
cctatggacgttgatcagagtactccatcacagaagcctgttgcatcagatggtgagcgg
ccaacctga

DBGET integrated database retrieval system