KEGG   Aegilops tauschii (wheat D): 109750703Help
Entry
109750703         CDS       T04345                                 

Gene name
LOC109750703
Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 7-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00052  Galactose metabolism
ats00500  Starch and sucrose metabolism
ats01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ats00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    109750703 (LOC109750703)
   00500 Starch and sucrose metabolism
    109750703 (LOC109750703)
Enzymes [BR:ats01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     109750703 (LOC109750703)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: XP_020165245
Position
Unknown
AA seq 546 aa AA seqDB search
MNGLEHPRNGRTAYHFQPAKFWQNDPNGPLYHNGMYHFFYQYNPKGATWGDGTLSWGHSV
SGDLVNWADVGNALDPTSPFDANGCWSGSATVLPGGRPAILYTGIDANRVQVQNVAFAKN
PADPLLREWEKPDCNPVMPMPADVTGNNFRDPTEAWRGRDGLWRVGVVAEVGGVGSLLVY
RSADFLRWERNAAPLHASSRDVPVLECPDLFPMAPPGAAEGLEVSASGAGVLHVLKLTDF
AKEDHYMVGRYDDEADTFVPAEPERGDDPGNWRRLDHGHVYASKSFYDARNKRRVLWAWV
DENDGGGVARGWAGIQAFPRAIWLDADGKRLVQWPIEEIETLRRKRVGLQWATEVEAGGR
KEIAGIVSSQADVEAIFEIPNLEEAETLDPKWLQDPKGLSAEMGASGRGGVGPFGLLALA
SGDLEEHTAVFFRVFKHDGKYKVLMCTDLTRSSRKEGINKPSYGAFLDMDVEKERSISLR
TLIDHTVVESFGDGGRTCMTARVYPEHAATGSSRLYAFNYGAGAVKVSKLEAWELATAAV
NGGGDM
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgaatggactcgagcacccgcgcaatggccggaccgcctaccacttccagccggccaag
ttctggcagaatgatcccaacgggccactgtaccacaacggcatgtaccacttcttctac
cagtacaaccccaagggcgccacctggggcgacggcacgctctcatggggccactccgtc
tccggcgacctcgtgaactgggccgacgtcggcaatgcgctcgaccccacctccccgttc
gacgccaacggctgctggtcgggctccgccaccgtgctcccaggcggccgcccggccatc
ctctacaccggcatcgacgccaaccgggtgcaggtacagaacgtggccttcgccaagaac
cccgccgacccgctcctccgcgagtgggagaagcccgactgtaacccggtcatgcccatg
ccggcggacgtcaccggcaacaacttccgcgaccccactgaggcgtggcgcggccgcgac
ggcctgtggagggtcggcgtcgtcgcggaggtcggcggcgtggggtccctgctcgtgtac
cggagcgcggacttcctccgctgggagcgcaacgccgcgcctctgcacgccagctcgcgg
gacgtgcccgtgctggagtgcccggacctgttccccatggcgccgcccggcgcggcggag
gggctcgaggtgtcggcgagcggcgccggggtgttgcacgtgctgaagctcacggacttc
gccaaggaggaccactacatggtcggccggtacgacgacgaggcggacaccttcgtgccg
gcggagcccgagcgcggcgacgatcccggcaactggcgccggctcgaccacggccacgtg
tacgcgtccaagtccttctacgacgcccgcaacaagcggcgcgtgctgtgggcgtgggtc
gacgagaacgacggcggcggcgtcgccaggggctgggcgggcatccaggcgttcccgagg
gcgatctggctggacgccgacgggaagcggctggtgcagtggccgatcgaggagatcgag
acgctgaggaggaagcgggtgggcctgcagtgggcgacggaggtggaggccggcggcagg
aaggagatcgccggcatcgtgagctcgcaggcggacgtggaggcgatcttcgagatcccg
aacctggaggaggcggagacgctggacccgaagtggctgcaggatcccaaggggctgtcc
gccgagatgggcgcgtccgggcgcggcggagtcgggccgttcgggctgctggccttggct
tccggcgacctggaggagcacaccgccgtcttcttcagggtgttcaagcacgatggcaag
tacaaggtcctcatgtgcaccgatctgacaagatcatcgaggaaggaggggataaacaag
ccatcctacggggcatttctggacatggacgtggagaaggagaggagcatctcgctcaga
acactgatcgaccacacggtggtggagagcttcggcgacggcgggaggacgtgcatgacg
gcccgggtgtacccggagcacgcggcgacgggcagcagccggctgtacgcgttcaactac
ggcgccggggccgtgaaggtgtcgaagctggaggcgtgggagctggcgacggccgccgtg
aacggcggaggcgatatgtag

DBGET integrated database retrieval system