KEGG   Aegilops tauschii (wheat D): 109752118Help
Entry
109752118         CDS       T04345                                 

Gene name
LOC109752118
Definition
(RefSeq) protein PHYLLO, chloroplastic isoform X1
  KO
K14759  isochorismate synthase / 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase / 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase / O-succinylbenzoate synthase [EC:5.4.4.2 2.2.1.9 4.2.99.20 4.2.1.113]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00130  Ubiquinone and other terpenoid-quinone biosynthesis
ats01100  Metabolic pathways
ats01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    109752118 (LOC109752118)
Enzymes [BR:ats01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     109752118 (LOC109752118)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     109752118 (LOC109752118)
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     109752118 (LOC109752118)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     109752118 (LOC109752118)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N MR_MLE_C Abhydrolase_6 TPP_enzyme_M_2 Abhydrolase_1 Hydrolase_4 TPP_enzyme_C Abhydrolase_2 Ndr Thioesterase LIDHydrolase Abhydrolase_3 DLH DUF676 TPP_enzyme_M Abhydro_lipase
Motif
Other DBs
NCBI-ProteinID: XP_020166574
Position
Unknown
AA seq 1715 aa AA seqDB search
MLVVSLSPSSPLSFLPVPNPRPFVVSPLRRYCLHKHHKRRQCRGGSGLPLHLLHAVARRR
TGIVIDVDEVNDIGDRDLPVDVSFTRRLPPALTLVDGIAALRRAAEEVKASPPAAGSGVI
RFEVLVPPSTKALKWLCSQFRRSSLFPQFYLSRKLSSNPSVQLEISGVGSALCLHGSSSQ
VKDGYDMISRYISFDSDLMGAYGAVGMKYNEELSSIEEKAGSFYFFIPQVELTEFVGYSV
LSSTMVWDHFVSHTFEDSVCLFESCFNQVCGSYDSAASSCYEGMMTNYIGESHLLETVNA
QLVYLDGEVLVKVDAEISMQKEKFLMSEQSFIRFSPHFLFSANMDLRSESNKTESSIKSC
SNINSAWASLIVEECVRLGFTYFCIAPGSRSSPLALSATGHPLTTCISCYDERSLGFHAL
GYGRGSRKPAIVITSSGTAVSNLLPSVVEASQDFVPVILLTADRPPELHDTGANQAINQV
NHFSNFVRYFFNLPPPGDQIYARMVLTTIDSAAYNAMQAPQGPVHINCAFREPLDHSNQN
WSFDCLRGLDRWFRNDEPYTRYLEMKMVSAFGNYSCSVIEVQDIIKKAKQGLLLVGAIHK
EDDMWAVALLARQLSWPVAADILSGLRMRKVLNSFPGFDKSILFIDQIDQILLSDSVKSW
INPDVIVQIGSRITSKRMEMFLESCFPSSYILIDTHPCRHDPSHVVTHRIQTSVADFAAS
LCQCNLERKTSRWKDILMVLNSAVSQEIMFHVHAEFLLTEPYVAHVIGEALYGDAAMFVG
NSMVIRDLNMFGKGWLDHTTNGDNMMMHNIPDFIGATVSGNRGASGIDGLLSTAIGFAVG
SNKHVCCVVGDVSFLHDTNGLSLLNQRAQRKPMTVIVINNHGGAIFSLLPVAKTASPQIL
QKYFYTSHDISISKLCDAHRVKHFLVQTKAELHDTLVKTHAEHLDCVVEVENQIDENANF
HRTISMFVDNTATHYLEYLLGDLYSSTTSDLDRMYNTKIHAIEYMLYRIQLSAPRTSGIS
DSSCFHEGFILKLRMDDNIVGFGEVAPIEIHQEDIIDVEEQLRFLFHRVKDCELDVVPLL
RGSFSNWIWTSIGIPPSSVFPSVKCGLEMAILNLLASQRKCRLSEILTGSNPLLRDQSLV
EYNQNSSAGIHICALLDSDGTPMEVALAVTKLVDEGFTTVKLKVGRRASPAEDAAVIQKI
REVVGYKINIRADANRKWTYKQAIEFGSRVKSLCLQYIEEPVSSVHDLIKFCENSGLPVA
LDESIDNLKGGPIQKLHQFVHPGIVAVVIKPSVVGGFENAAHIAKWAHMHDKMAIISSAY
ESSVGLATYIQFAYYVDRQHDLISRLKRYDSCGTVAHGFGTYQWLTEDVSEQKLKILVPP
LGDGMGASVEDAHGYLHHLNINDEKIEKTYSEEKLNSYSIQVDGDHFSYVVKVQEAGDCT
NDKVVLFLHGFLGTSEDWTPMMKALSPSARVIAVDLPGHGESQILQRDDENFNQISLTIQ
SVADLLLKLICNITDGEVVVVGYSMGARIALQMILNENHKISGAVLISGSPGLRHEASRR
RRTAIDKSRAQFLLTYGLECFIKTWYSGKMWTSLREHPQFDSLVRTRRKHSNITDLSKVL
ADSSIGRQKSLWEDLKHLEKPVLIVAGEKDVKFKEIAERMCSETREYGEREADCRSNQEL
CEMIVVPESGHAVHVENPLPLVRALRKFLVRLHQP
NT seq 5148 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtcgtctccctttctccgagctcacccctctccttcctccctgtcccgaacccc
cgcccttttgtcgtctcccctcttcgccgctactgcctccacaaacaccacaagcgccgg
caatgccgcggtggcagtggcctaccactccacctcctccacgccgtcgccaggaggcga
acgggcatcgtgatcgacgtcgacgaggtgaatgatatcggcgaccgtgacctccccgtg
gacgtgtcattcactcggaggctcccgccggcgctcaccctcgttgacggcattgccgca
ctgcggcgggccgccgaggaggtgaaggccagcccgcctgccgccgggagcggcgtgatc
cggttcgaggtacttgttccacccagtacgaaggcactcaaatggttatgctctcagttt
aggagatcatcattgttccctcagttctatctatcaaggaagctaagctccaatccgtca
gttcaacttgaaatatctggtgttggttctgcactttgcttgcatggttcctcttctcaa
gtaaaagatggatatgatatgatatcaagatatatttcatttgattcagatttgatggga
gcttatggagcagttggcatgaagtataacgaggaattatcgtcaatagaggagaaagct
ggttcattttacttctttattcctcaggttgagttgaccgaatttgttggctattctgtg
ctatcatcaactatggtttgggatcattttgtatctcatacatttgaggattcggtttgt
ttgtttgaatcttgtttcaatcaggtatgtggtagctatgattctgcagctagcagctgt
tatgaaggcatgatgacgaattacattggagaatcacatttgttagagactgtgaatgct
cagttggtatacttggatggcgaagttcttgtcaaagtagatgctgaaatcagcatgcaa
aaggagaaatttctgatgtccgagcagtcatttattcgcttttcaccacacttcttattt
tctgcaaacatggacctacgctcagaaagcaacaaaaccgaatcttctattaagagctgc
tctaacattaattcggcatgggcatcccttatagttgaagagtgtgtcaggcttggtttc
acgtacttttgtatagctccagggtcaaggtcatccccactcgcactttctgccacaggc
caccctttgacaacttgcatatcatgttatgatgaacgttcacttggatttcatgctctt
ggctatgggagaggttctagaaagcctgctatagtaattacatcatcaggaactgctgta
tcaaatcttctcccttcggtggtggaggcaagtcaagatttcgtaccagttatcttgctc
acagctgatcgtcctcccgagctgcatgatactggagccaaccaagcgattaatcaggtc
aatcatttcagtaactttgtaagatatttttttaatctccctccacctggtgatcagatt
tatgcaagaatggttcttacaacaattgattcagcagcctacaatgcaatgcaagcacca
caaggtccggtgcatataaactgtgcttttagggaaccactagatcacagcaatcaaaat
tggagttttgattgtttgagaggattggacaggtggtttagaaatgatgaaccatatact
agatacctagaaatgaaaatggtctccgcatttggtaattattcttgttcagtaatagag
gttcaagatatcataaagaaggcaaagcaagggcttctattagttggagctattcataaa
gaagatgacatgtgggctgtggctttactagctagacaactttcctggccagttgctgct
gacattctgtctggactgcgaatgaggaaagttctaaattcatttccaggatttgataag
agtattttgtttatagaccaaatagaccaaattctactgtcggactctgtcaaaagctgg
ataaatccagatgttattgtgcagattggaagccggattactagcaaacgcatggaaatg
tttctcgagtcctgcttcccatcttcatacatcttgattgatacacatccgtgccgccat
gatccttcacatgttgtcactcacagaatccagactagtgtagctgactttgctgctagt
ttgtgccaatgtaatttagaaaggaagacaagcagatggaaggatattttgatggttcta
aattcagcggtttcacaggaaataatgtttcatgtacatgcggaattcttgcttacagaa
ccatatgttgcacatgtaattggagaggcactttatggtgatgctgccatgtttgttggg
aatagcatggtcattcgagacttgaacatgtttgggaagggctggcttgaccatactacc
aacggagataacatgatgatgcataatattccagatttcattggtgcaacagtgtctggg
aaccgaggagcaagtggtattgatggtttgcttagcaccgcgattggattcgctgttggg
tcaaacaagcatgtatgctgtgtggttggtgatgtatcttttcttcatgatacgaacgga
ttgtcacttctcaaccaaagggcccagaggaaacccatgacagtgattgtaatcaacaac
catggtggtgcaatcttcagccttctaccagttgcaaaaacagcttcgccccaaattttg
cagaaatacttctacacctcacatgacatatcgatttctaaactctgtgatgcacacaga
gtgaagcattttttggttcaaacaaaagcagaacttcatgatacattggtgaagacccat
gcagaacaccttgattgtgtggtggaagtagagaaccagattgatgagaatgccaacttt
catagaactataagtatgttcgttgataatactgcaacccactatctggagtatcttctc
ggggatctgtattctagcactacgagtgatttagatcgcatgtacaatacgaaaattcat
gcaatagagtacatgttgtacagaatccagctttctgcacctcgtacttcaggaatttca
gatagcagttgtttccatgaaggcttcattctgaagctacgtatggatgacaacattgta
ggatttggtgaggttgcaccaatcgaaattcaccaggaggatataatagatgtcgaagag
caacttaggtttctgtttcacagagtgaaagattgtgagctagatgttgttcctttgttg
agagggtctttctccaattggatatggacaagcattgggattcctccttcttctgtattt
ccaagtgtcaagtgtggcctggagatggccattcttaatttgctggcgtcacagcggaaa
tgtagattatctgaaattctcactggttccaaccccttactaagagatcagagtctggtg
gaatataatcagaacagttctgcaggcatacatatctgtgcactcttagactccgacggt
actccgatggaggtagcacttgctgtgactaaacttgttgatgaaggctttaccacagtg
aaactgaaggttggacgtcgtgcaagtcccgctgaagatgcagctgttattcaaaaaata
agagaggttgtaggatataagatcaatatccgtgccgatgcaaatcgaaaatggacatac
aagcaagcaattgaatttggatccagagtaaaaagcctttgtttgcaatacattgaggaa
ccagtgagctctgtacatgatctcatcaagttctgtgaaaacagtggtttgcctgttgct
ttagacgagagtatcgacaaccttaaggggggtccaatccaaaagcttcatcaatttgta
catccagggatagttgctgttgttataaaacccagtgttgttggcggctttgagaatgca
gctcatatagcaaagtgggctcacatgcatgataagatggctatcatcagtagtgcgtac
gagagttctgtaggtttggcgacctacatacagtttgcatattatgttgacaggcaacat
gacctaatctccagactaaagagatatgattcatgtggaactgtggctcatgggtttgga
acatatcaatggttaacagaagatgtatcagaacaaaagttaaaaattcttgttcccccg
cttggtgatggaatgggagcttcagtggaagatgcccatggctatctccaccacttaaat
ataaatgatgagaagattgaaaaaacatatagtgaagaaaaactaaactcatattctatc
caagtcgacggggatcatttttcttatgtagttaaggttcaagaggctggtgattgtaca
aatgataaggtcgttctttttcttcatggatttcttggcacaagtgaggactggactccc
atgatgaaagctctctctcccagtgcacgggtcatcgccgttgatcttcctggccatgga
gagtcccaaattctgcagcgcgatgatgaaaatttcaatcaaatctctcttacaattcaa
tcagttgcagacttgttgctgaagttgatatgcaatataactgatggagaggtggttgtt
gttggctactcaatgggtgcaaggattgcactccagatgatactaaatgaaaatcacaag
attagtggagctgttttgatatcggggagtcctggattgagacatgaagcaagtagaaga
cgacgtactgctattgataaatcacgagctcaattcctgttgacttatggactggaatgt
tttatcaagacatggtactctggaaaaatgtggaccagtctaagagaacacccacagttt
gattccctagtgaggacacgcagaaaacacagtaacatcacggatctatctaaggttctg
gctgactcgagcatagggagacaaaagtccctgtgggaagacctgaaacacttggagaag
cctgtcctcatcgttgcaggtgagaaggacgtaaaatttaaagagatagcggagcgaatg
tgcagcgagacaagagagtacggcgaacgtgaagctgattgtcgtagcaatcaggagcta
tgtgaaatgatcgttgtcccggaaagtggccatgctgtgcatgttgagaaccctctcccc
ttagttagagccctgaggaagttcttggtaaggctacaccagccttaa

DBGET integrated database retrieval system