KEGG   Aegilops tauschii (wheat D): 109755507Help
Entry
109755507         CDS       T04345                                 

Gene name
LOC109755507
Definition
(RefSeq) heat shock 70 kDa protein PPF203-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats03040  Spliceosome
ats04141  Protein processing in endoplasmic reticulum
ats04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ats00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    109755507 (LOC109755507)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109755507 (LOC109755507)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109755507 (LOC109755507)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ats01009]
    109755507 (LOC109755507)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ats03041]
    109755507 (LOC109755507)
   03009 Ribosome biogenesis [BR:ats03009]
    109755507 (LOC109755507)
   03110 Chaperones and folding catalysts [BR:ats03110]
    109755507 (LOC109755507)
   04131 Membrane trafficking [BR:ats04131]
    109755507 (LOC109755507)
   03051 Proteasome [BR:ats03051]
    109755507 (LOC109755507)
   03029 Mitochondrial biogenesis [BR:ats03029]
    109755507 (LOC109755507)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ats04147]
    109755507 (LOC109755507)
Protein phosphatases and associated proteins [BR:ats01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     109755507 (LOC109755507)
Spliceosome [BR:ats03041]
 Complex B
  Other components
   Prp19 complex
    109755507 (LOC109755507)
 Complex C
   Prp19-CDC5 complex
    109755507 (LOC109755507)
Ribosome biogenesis [BR:ats03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    109755507 (LOC109755507)
Chaperones and folding catalysts [BR:ats03110]
 Heat shock proteins
  HSP70 / DNAK
   109755507 (LOC109755507)
Membrane trafficking [BR:ats04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    109755507 (LOC109755507)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    109755507 (LOC109755507)
Proteasome [BR:ats03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    109755507 (LOC109755507)
Mitochondrial biogenesis [BR:ats03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    109755507 (LOC109755507)
Exosome [BR:ats04147]
 Exosomal proteins
  Proteins found in most exosomes
   109755507 (LOC109755507)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 Glyco_hydro_63N
Motif
Other DBs
NCBI-ProteinID: XP_020170000
Position
Unknown
AA seq 105 aa AA seqDB search
MGAIRPYEGEGALTKDNRLLGVFTLTGIPPAPRGVPNFKVTFEIEENGVLKVVAKDRETG
NKNSITIASDKGGLSKYEIDRMVRDANKCKSEEKKQMKNVKEERG
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggagctattcgcccgtacgagggtgaaggggctttgaccaaggacaacaggcttctg
ggcgtgttcacgctcactggcatccctccagcgccaagaggcgtgccaaatttcaaagtg
acgttcgaaatcgaggaaaacggcgttctgaaggtcgtggcaaaggacagggagaccgga
aacaagaacagcatcaccatcgccagcgacaagggtgggctgagcaagtacgagatagat
cgtatggtgcgtgatgctaacaagtgcaagtctgaggagaagaagcagatgaagaacgtg
aaggaggaacgcggatag

DBGET integrated database retrieval system